BYKdb

Annotate results for A0A0L6CVX1

A0A0L6CVX1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0L6CVX1
DOMAINcd48/232TSATPDCGKSFVAANLAISLSRQSGLRTVLMDMDLRRPSLAKMLGISEPGSMSRFLTGEL
SAERHFLRPDKNAMHIGPHLALGLNDRAEAYAAELLQAPGTAAVLADLCARLAPDVVIFD
MPPALYYDDVLGFRPQFDGVLLVVGGGRSTAKEVRDLKARFGDEVPLLGVVMNRAEGENI
TKYGY
SITEWalker A55/57GKS
SITEWalker A'76/83VLMDMDLR
SITEWalker B164/170VIFDMPP
SITE-173/-174YY
SITEY Cluster230/232YGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPLDTRHLIRNRLISATREDPAHVAFDVLRTKLVATLRARGWHRVAITSATPDCGKSFVAANLAISLSRQSGLRTVLMDM
                                               TSATPDCGKSFVAANLAISLSRQSGLRTVLMDM
                                                      GKS                  VLMDM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRRPSLAKMLGISEPGSMSRFLTGELSAERHFLRPDKNAMHIGPHLALGLNDRAEAYAAELLQAPGTAAVLADLCARLA
DLRRPSLAKMLGISEPGSMSRFLTGELSAERHFLRPDKNAMHIGPHLALGLNDRAEAYAAELLQAPGTAAVLADLCARLA
DLR                                                                             
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
PDVVIFDMPPALYYDDVLGFRPQFDGVLLVVGGGRSTAKEVRDLKARFGDEVPLLGVVMNRAEGENITKYGY
PDVVIFDMPPALYYDDVLGFRPQFDGVLLVVGGGRSTAKEVRDLKARFGDEVPLLGVVMNRAEGENITKYGY
   VIFDMPP                                                           YGY
© 1998-2019