BYKdb

Annotate results for A0A0L6JIJ7

A0A0L6JIJ7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0L6JIJ7
DOMAINcd42/228TSYSSGDGKSCVSANLSYTIAKSGMKVLFVDADLRKPILYKKLVSKDFKGLSNYLLGNST
LEQIINKTQIEGFDFVSCGIKTLSPGELIASPRLGEFLIKTREIYDFVIIDTPPLGSVID
GALISSQSDAAIIVVSQYKTKCNNAIMMKEQLQKANANILGVVFNKVNKLDFRNYYGGYD
YDNKKTK
SITEWalker A49/51GKS
SITEWalker A'69/76LFVDADLR
SITEWalker B149/155VIIDTPP
SITEY Cluster216/222YYGGYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTTINYEHEFKINESLEEAFKVLRANIHFCDPENKLKTIAITSYSSGDGKSCVSANLSYTIAKSGMKVLFVDADLRKPIL
                                         TSYSSGDGKSCVSANLSYTIAKSGMKVLFVDADLRKPIL
                                                GKS                 LFVDADLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YKKLVSKDFKGLSNYLLGNSTLEQIINKTQIEGFDFVSCGIKTLSPGELIASPRLGEFLIKTREIYDFVIIDTPPLGSVI
YKKLVSKDFKGLSNYLLGNSTLEQIINKTQIEGFDFVSCGIKTLSPGELIASPRLGEFLIKTREIYDFVIIDTPPLGSVI
                                                                    VIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGALISSQSDAAIIVVSQYKTKCNNAIMMKEQLQKANANILGVVFNKVNKLDFRNYYGGYDYDNKKTKYSRKLLKEIKNV
DGALISSQSDAAIIVVSQYKTKCNNAIMMKEQLQKANANILGVVFNKVNKLDFRNYYGGYDYDNKKTK            
                                                       YYGGYDY                  
     
....:
KRDNL


© 1998-2019