BYKdb

Annotate results for A0A0L6JLG6

A0A0L6JLG6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0L6JLG6
DOMAINtad7/142VEVDIRELILILLRKWYILLICLVVATGAAYTVTAFYLKPVYRAETTLFLGKEKDKIGAL
SLLDLQINSQLVVDYREILKSRLVAEKIQSQLGVEAKAFQNNVDVMTIKDSRIFKISYED
YDPKLAAKVVNELGTI
DOMAINcd283/464TSPSLGDGKTVTTVNLAITLAQSGKKVLVIDADLRKPKVHHYFGVKNTEGLTNILATEKE
LKKSMIQNKEGIENLFIIPSGPIPPNPSEILSSDKMRQLVEKLKSEYDVIFIDTPPVGQV
TDAAILTGIADGSIVVVAGGQTRIDMAKRAKKALTAINANIIGIVMTKIDSRSAYYHYYK
YE
SITEWalker A290/292GKT
SITEWalker A'310/317LVIDADLR
SITEWalker B392/398IFIDTPP
SITEY Cluster457/463YYHYYKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQDKDFVEVDIRELILILLRKWYILLICLVVATGAAYTVTAFYLKPVYRAETTLFLGKEKDKIGALSLLDLQINSQLVVD
      VEVDIRELILILLRKWYILLICLVVATGAAYTVTAFYLKPVYRAETTLFLGKEKDKIGALSLLDLQINSQLVVD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YREILKSRLVAEKIQSQLGVEAKAFQNNVDVMTIKDSRIFKISYEDYDPKLAAKVVNELGTIIMQLASDIIEVKNVKVID
YREILKSRLVAEKIQSQLGVEAKAFQNNVDVMTIKDSRIFKISYEDYDPKLAAKVVNELGTI                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAKDPKDPVKPNKKMNVGLAGFLGILLGVSLIYLLEFIDHTFKKPEDVEHHLGLNVIGTVPAFEGGKRGNKKAKDEKQLE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEYLKNLITANDPKAAASEAYRELRTNLQYKSVDKDMKVILLTSPSLGDGKTVTTVNLAITLAQSGKKVLVIDADLRKPK
                                          TSPSLGDGKTVTTVNLAITLAQSGKKVLVIDADLRKPK
                                                 GKT                 LVIDADLR   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VHHYFGVKNTEGLTNILATEKELKKSMIQNKEGIENLFIIPSGPIPPNPSEILSSDKMRQLVEKLKSEYDVIFIDTPPVG
VHHYFGVKNTEGLTNILATEKELKKSMIQNKEGIENLFIIPSGPIPPNPSEILSSDKMRQLVEKLKSEYDVIFIDTPPVG
                                                                       IFIDTPP  
       410       420       430       440       450       460    
....:....|....:....|....:....|....:....|....:....|....:....|....
QVTDAAILTGIADGSIVVVAGGQTRIDMAKRAKKALTAINANIIGIVMTKIDSRSAYYHYYKYE
QVTDAAILTGIADGSIVVVAGGQTRIDMAKRAKKALTAINANIIGIVMTKIDSRSAYYHYYKYE
                                                        YYHYYKY 
© 1998-2019