BYKdb

Annotate results for A0A0L6U303

A0A0L6U303 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0L6U303
DOMAINcd41/228TSTNKSSGKTTILSNYAVALAQSGKRTLLLDCDLRRPKIHKKFELSNNKGLTNILLKEIE
VINGIQETEVPNLFVISSGPIPPNPSEILASRRMGELVAELKNNFDYILLDAPPVGMVTD
AAVLSSVAEGYILVVAIGNCDRDGVRYSLESLAKVNANVIGIVANKVPINKRSGYYAYYS
AYEEDRVL
SITEWalker A48/50GKT
SITEWalker A'68/75LLLDCDLR
SITEWalker B148/154ILLDAPP
SITEY Cluster215/222YYAYYSAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQDTIITFRLPKSPISEAFRNMRTNITFSDIDNELQVLAITSTNKSSGKTTILSNYAVALAQSGKRTLLLDCDLRRPKIH
                                        TSTNKSSGKTTILSNYAVALAQSGKRTLLLDCDLRRPKIH
                                               GKT                 LLLDCDLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKFELSNNKGLTNILLKEIEVINGIQETEVPNLFVISSGPIPPNPSEILASRRMGELVAELKNNFDYILLDAPPVGMVTD
KKFELSNNKGLTNILLKEIEVINGIQETEVPNLFVISSGPIPPNPSEILASRRMGELVAELKNNFDYILLDAPPVGMVTD
                                                                   ILLDAPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVLSSVAEGYILVVAIGNCDRDGVRYSLESLAKVNANVIGIVANKVPINKRSGYYAYYSAYEEDRVLNEKTKKKQLKKE
AAVLSSVAEGYILVVAIGNCDRDGVRYSLESLAKVNANVIGIVANKVPINKRSGYYAYYSAYEEDRVL            
                                                      YYAYYSAY                  
  
..
PI


© 1998-2019