BYKdb

Annotate results for A0A0L6ZCA8

A0A0L6ZCA8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0L6ZCA8
DOMAINcd38/229TSSGPSEGKSTTAGNLALSMAQADKKILIIDCDLRKPTVHKKFNISNEKGLSNYLIGEVK
LEEVMTKYSDNLYLLTSGTIPPNPAEILSSKKMKEFLESVKNQFDSIVIDSPPVLAVTDA
QILSTIVEGVLLVVATGETEKEATIKSKELLKKVNANILGVVMTKMPVKTGKGYGYGYGY
GYYYYYGEDHKK
SITEWalker A45/47GKS
SITEWalker A'65/72LIIDCDLR
SITEWalker B144/150IVIDSPP
SITE-105/-110YSDNLY
SITEY Cluster211/223YGYGYGYGYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDNNIKTILVTSSGPSEGKSTTAGNLALSMAQADKKILIIDCDLRKPTVHKKF
                                     TSSGPSEGKSTTAGNLALSMAQADKKILIIDCDLRKPTVHKKF
                                            GKS                 LIIDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NISNEKGLSNYLIGEVKLEEVMTKYSDNLYLLTSGTIPPNPAEILSSKKMKEFLESVKNQFDSIVIDSPPVLAVTDAQIL
NISNEKGLSNYLIGEVKLEEVMTKYSDNLYLLTSGTIPPNPAEILSSKKMKEFLESVKNQFDSIVIDSPPVLAVTDAQIL
                                                               IVIDSPP          
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
STIVEGVLLVVATGETEKEATIKSKELLKKVNANILGVVMTKMPVKTGKGYGYGYGYGYYYYYGEDHKKHTKRGKKKK
STIVEGVLLVVATGETEKEATIKSKELLKKVNANILGVVMTKMPVKTGKGYGYGYGYGYYYYYGEDHKK         
                                                  YGYGYGYGYYYYY               
© 1998-2019