BYKdb

Annotate results for A0A0L7BSV7

A0A0L7BSV7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0L7BSV7
DOMAINtad47/186EGMTIVDLLSILRKHIITIAVTFVVILGVDILYTAMSPVAYTTTTQLFATYNSSNDSANS
SEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTNTAFVNI
AVTDADPSTAARIANGVAAS
DOMAINcd319/506TSAGASEGKTTTSVNIAAALAEDGSRVLLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAA
VKDVIQRYWKPNLHIIPAGPKPPNASTLLNSPLMTTLVANAMQQYDYIIIDTAPMVVAND
AVIFMKQGGTLEMVCCRDHTLKRDLREIASELETLDMPVTGVIINCAKENKKALENSNYY
YYSNSSPA
SITEWalker A326/328GKT
SITEWalker A'346/353LLIDADLR
SITEWalker B426/432IIIDTAP
SITE-423/-425YDY
SITEY Cluster497/500YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRLKRKPRDSSDLSGASMLEWKALYMAENEVNRYSQSQSQTPVPAHEGMTIVDLLSILRKHIITIAVTFVVILGVDILYT
                                              EGMTIVDLLSILRKHIITIAVTFVVILGVDILYT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMSPVAYTTTTQLFATYNSSNDSANSSEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTN
AMSPVAYTTTTQLFATYNSSNDSANSSEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAFVNIAVTDADPSTAARIANGVAASLSNVVEKSLYTAGSNSAVKLSIVQPAQVPTKPSSPKWSLNLLAGILGGLIIGIL
TAFVNIAVTDADPSTAARIANGVAAS                                                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AALLKDVLSKKIQDESDVTDIVDAPIIGRVVKDDILTGSSPVVVSEPGSPIAEDFRRIRTNLSFSTPVEGTNCRLIVVTS
                                                                              TS

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGASEGKTTTSVNIAAALAEDGSRVLLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPKP
AGASEGKTTTSVNIAAALAEDGSRVLLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPKP
     GKT                 LLIDADLR                                               
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNASTLLNSPLMTTLVANAMQQYDYIIIDTAPMVVANDAVIFMKQGGTLEMVCCRDHTLKRDLREIASELETLDMPVTGV
PNASTLLNSPLMTTLVANAMQQYDYIIIDTAPMVVANDAVIFMKQGGTLEMVCCRDHTLKRDLREIASELETLDMPVTGV
                         IIIDTAP                                                
       490       500       510     
....:....|....:....|....:....|....:
IINCAKENKKALENSNYYYYSNSSPAEKNRKNRKS
IINCAKENKKALENSNYYYYSNSSPA         
                YYYY               
© 1998-2019