BYKdb

Annotate results for A0A0L7NHF7

A0A0L7NHF7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0L7NHF7
DOMAINcd38/225TSSGPSEGKSTTSGNLALSMAQSDRKVLLVDCDLRKPTVHKKFHISNEKGLSNYLVGEAL
FEEVIVKYNENLSLLPAGTIPPNPAEMVASKKMKSFLDSLKGKFDCVLIDTPPVIAVTDA
QILSTVVDGVLLVAASGQAEKEAATRAKELLLKVNANILGVVLTKVPLNEGKGYGYSYYY
YYGNEDEE
SITEWalker A45/47GKS
SITEWalker A'65/72LLVDCDLR
SITEWalker B144/150VLIDTPP
SITEY Cluster211/219YGYSYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDKELKTIIVTSSGPSEGKSTTSGNLALSMAQSDRKVLLVDCDLRKPTVHKKF
                                     TSSGPSEGKSTTSGNLALSMAQSDRKVLLVDCDLRKPTVHKKF
                                            GKS                 LLVDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HISNEKGLSNYLVGEALFEEVIVKYNENLSLLPAGTIPPNPAEMVASKKMKSFLDSLKGKFDCVLIDTPPVIAVTDAQIL
HISNEKGLSNYLVGEALFEEVIVKYNENLSLLPAGTIPPNPAEMVASKKMKSFLDSLKGKFDCVLIDTPPVIAVTDAQIL
                                                               VLIDTPP          
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
STVVDGVLLVAASGQAEKEAATRAKELLLKVNANILGVVLTKVPLNEGKGYGYSYYYYYGNEDEESKKGRRHKK
STVVDGVLLVAASGQAEKEAATRAKELLLKVNANILGVVLTKVPLNEGKGYGYSYYYYYGNEDEE         
                                                  YGYSYYYYY               
© 1998-2019