BYKdb

Annotate results for A0A0M0G0K3

A0A0M0G0K3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M0G0K3
DOMAINcd43/222TSSGPGEGKSTTAANLAVVFAQEGKNVLLVDGDMRKPTSHYTFNVNNTFGLTSALSRQKT
LREVVHQTDIKNLDLLTCGPVPPNPAELLSSRSMEELLNDIYQDYDLVVFDTPPLLAVTD
AQVLANKCDGTVLVLSSGTTEIDSAKKAKELLDTTNGRLLGVILNNREIKDTSYYYYGKK
SITEWalker A50/52GKS
SITEWalker A'70/77LLVDGDMR
SITEWalker B150/156VVFDTPP
SITE-144/-147YQDY
SITEY Cluster216/219YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTRRKLVTHDNPQSPISEQYKTIRTSINFSSIDQQIRSIMVTSSGPGEGKSTTAANLAVVFAQEGKNVLLVDGDMRKPT
                                          TSSGPGEGKSTTAANLAVVFAQEGKNVLLVDGDMRKPT
                                                 GKS                 LLVDGDMR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SHYTFNVNNTFGLTSALSRQKTLREVVHQTDIKNLDLLTCGPVPPNPAELLSSRSMEELLNDIYQDYDLVVFDTPPLLAV
SHYTFNVNNTFGLTSALSRQKTLREVVHQTDIKNLDLLTCGPVPPNPAELLSSRSMEELLNDIYQDYDLVVFDTPPLLAV
                                                                     VVFDTPP    
       170       180       190       200       210       220  
....:....|....:....|....:....|....:....|....:....|....:....|..
TDAQVLANKCDGTVLVLSSGTTEIDSAKKAKELLDTTNGRLLGVILNNREIKDTSYYYYGKK
TDAQVLANKCDGTVLVLSSGTTEIDSAKKAKELLDTTNGRLLGVILNNREIKDTSYYYYGKK
                                                       YYYY   
© 1998-2019