BYKdb

Annotate results for A0A0M0I0S7

A0A0M0I0S7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M0I0S7
DOMAINtad14/205RTIDLGYYYHLVKSRWLSIAAFTTLCTAIAVLFALSITPTYTATATLLIEASQKKAISIE
EVVGIDTRAKEYYQTQFEILKSNHVAQRVIDKLNLTQVAEFNPAMSIEEPSAVEELKQSV
KQWPLIRTLFPEEDVAEVDLKAEQEALNRSVLKTFKSKLTISPIRKTQLVNISFESEDPA
LAAKIANEVGQS
DOMAINcd550/737SSSVPGEGKTTTSVNLALSFAKLENVLLIDCDLRKPSIAQRFLLPNSHPGLVNHLVMDMP
IKDCITRIEGTKLDVLTAGMVAANPQELLSGEAFKNLIKRLSEQYDRIIIDTPPVLPVKD
SFLVGQLTHGIILVVKANSTTRSVYRHTMTLFTKHKVVADGVILNQVQVPKKGKHSYTEY
AAYSHATS
SITEWalker A557/559GKT
SITEWalker A'576/583LLIDCDLR
SITEWalker B657/663IIIDTPP
SITEY Cluster726/732YTEYAAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLTQSNADLPNQDRTIDLGYYYHLVKSRWLSIAAFTTLCTAIAVLFALSITPTYTATATLLIEASQKKAISIEEVVGIDT
             RTIDLGYYYHLVKSRWLSIAAFTTLCTAIAVLFALSITPTYTATATLLIEASQKKAISIEEVVGIDT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAKEYYQTQFEILKSNHVAQRVIDKLNLTQVAEFNPAMSIEEPSAVEELKQSVKQWPLIRTLFPEEDVAEVDLKAEQEAL
RAKEYYQTQFEILKSNHVAQRVIDKLNLTQVAEFNPAMSIEEPSAVEELKQSVKQWPLIRTLFPEEDVAEVDLKAEQEAL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRSVLKTFKSKLTISPIRKTQLVNISFESEDPALAAKIANEVGQSFIENNLESKLLATEQATSWINQRLAELKSKLDSSE
NRSVLKTFKSKLTISPIRKTQLVNISFESEDPALAAKIANEVGQS                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QALLQFLEAQKLIDDSGIVALTSSELSNLTDRIAQATEKRIETQALFNALKNNKSTDVATLSSISLISHHPQIRDIRLAE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQAEKVVSELSKRYGPKHDKMIQARAQLESIQRRADSIVKKLVNGIEKELSSAVNQEQLLKAELLEKKEEFQSLSVVKRE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDALKREVDTNAKLYDLFLTRQKETSATSDFSAANARFSDYAMVPQNPSKPNKKLIVAMAFVASMGMAVVICICLDAFNN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TIESSRDFENKLGLLPTGTIPAVKDKRFKKAPLDFRVFGEEKFAVFQESLDSIRTSLMLSHAQRKVLAISSSVPGEGKTT
                                                                     SSSVPGEGKTT
                                                                            GKT 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSVNLALSFAKLENVLLIDCDLRKPSIAQRFLLPNSHPGLVNHLVMDMPIKDCITRIEGTKLDVLTAGMVAANPQELLSG
TSVNLALSFAKLENVLLIDCDLRKPSIAQRFLLPNSHPGLVNHLVMDMPIKDCITRIEGTKLDVLTAGMVAANPQELLSG
               LLIDCDLR                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAFKNLIKRLSEQYDRIIIDTPPVLPVKDSFLVGQLTHGIILVVKANSTTRSVYRHTMTLFTKHKVVADGVILNQVQVPK
EAFKNLIKRLSEQYDRIIIDTPPVLPVKDSFLVGQLTHGIILVVKANSTTRSVYRHTMTLFTKHKVVADGVILNQVQVPK
                IIIDTPP                                                         
       730       
....:....|....:..
KGKHSYTEYAAYSHATS
KGKHSYTEYAAYSHATS
     YTEYAAY     

© 1998-2019