BYKdb

Annotate results for A0A0M0KRJ0

A0A0M0KRJ0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M0KRJ0
DOMAINcd50/227TSSVPGEGKSFSAANLAAVFAQQQEKKVLLVDADLRKPTINQTFQVENVTGLTNVLVGNA
SLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIFDSPPLLAVA
DAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
SITE-188/-190GKT
SITEWalker A'78/85LLVDADLR
SITEWalker B158/164VIFDSPP
SITEY Cluster225/227YSY
SITEWalker A57/59GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVFRKKKARRGLAQISVLHNKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
                                                 TSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
                                                        GKS                  LLV
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DADLR                                                                        VIF
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
DSPP                                                            YSY
© 1998-2019