BYKdb

Annotate results for A0A0M0LHP8

A0A0M0LHP8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M0LHP8
DOMAINcd53/237TSSVPGEGKSTTIANLATVFAQQDKRVLLIDGDLRKPTAHYTFRLENRMGLTNVLTKQTR
LASAIQRSEVKNLDILTSGPIPPNPAELLASQAMANLFTELYEHYELIVFDSPPILPVTD
AQILANQCDGAVLVVQSGRSDKEATQKAKELLDAAKGKLLGVVLNRKEQKASSGYYHYYG
TDNNN
SITEWalker A60/62GKS
SITEWalker A'80/87LLIDGDLR
SITEWalker B160/166IVFDSPP
SITE-154/-157YEHY
SITEY Cluster227/231YYHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKRFGKNKKVSNMRNLIAHLKPKSTISEQYRTIRTNIQFSNVDQKLRSIVVTSSVPGEGKSTTIANLATVFAQQDKRVL
                                                    TSSVPGEGKSTTIANLATVFAQQDKRVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDGDLRKPTAHYTFRLENRMGLTNVLTKQTRLASAIQRSEVKNLDILTSGPIPPNPAELLASQAMANLFTELYEHYELI
LIDGDLRKPTAHYTFRLENRMGLTNVLTKQTRLASAIQRSEVKNLDILTSGPIPPNPAELLASQAMANLFTELYEHYELI
LIDGDLR                                                                        I
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
VFDSPPILPVTDAQILANQCDGAVLVVQSGRSDKEATQKAKELLDAAKGKLLGVVLNRKEQKASSGYYHYYGTDNNN
VFDSPPILPVTDAQILANQCDGAVLVVQSGRSDKEATQKAKELLDAAKGKLLGVVLNRKEQKASSGYYHYYGTDNNN
VFDSPP                                                            YYHYY      
© 1998-2019