BYKdb

Annotate results for A0A0M0LLP3

A0A0M0LLP3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M0LLP3
DOMAINcd49/231TSASKGEGKSTVAANTAIAFAQEGKKVLLVDADLRKPTMHHTFNKLLSPGFTNLLMIQWK
IADVVKESGIKGLDLITCGPIPSNPAELLGSTSMDLFIKEAKALYDIVVFDAPPVLSVAD
AQILSEKCDGTILVINAGSTEKRFAVKTKEVLQSSKANIIGTILNNFKLEKGHYYYEYYG
QDV
SITEWalker A56/58GKS
SITEWalker A'76/83LLVDADLR
SITEWalker B156/162VVFDAPP
SITEY Cluster222/227YYYEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKKKRKEHRRKLITSTDPRSIVSEQFRMVRANIKFSMKDKQFCTLLFTSASKGEGKSTVAANTAIAFAQEGKKVLLVDA
                                                TSASKGEGKSTVAANTAIAFAQEGKKVLLVDA
                                                       GKS                 LLVDA
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKPTMHHTFNKLLSPGFTNLLMIQWKIADVVKESGIKGLDLITCGPIPSNPAELLGSTSMDLFIKEAKALYDIVVFDA
DLRKPTMHHTFNKLLSPGFTNLLMIQWKIADVVKESGIKGLDLITCGPIPSNPAELLGSTSMDLFIKEAKALYDIVVFDA
DLR                                                                        VVFDA
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
PPVLSVADAQILSEKCDGTILVINAGSTEKRFAVKTKEVLQSSKANIIGTILNNFKLEKGHYYYEYYGQDV
PPVLSVADAQILSEKCDGTILVINAGSTEKRFAVKTKEVLQSSKANIIGTILNNFKLEKGHYYYEYYGQDV
PP                                                           YYYEYY    
© 1998-2019