BYKdb

Annotate results for A0A0M0SU69

A0A0M0SU69 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M0SU69
DOMAINtad1/152MEKGLSSLPFILKRRALPALATFIAVIGGAIIYLQITPRLYETSTRLILDQKRVSVSELG
RDLTQLSSATPGGSNPLADQAELIKSQRILQKALTKVAAESGFSLPENELTVGQLSQNLK
VKIVPATNILEVSYLNKDPTLATRVVNAVSQA
DOMAINcd519/706SSTVTGEGKSVVASHLAVISAMLSRRTLLIDADLRRPVLHTLFNLVPQPGITDVIDSERS
LEETVQRTHIANLCVLTCGDLYGRPSHLLESEVMKSLMTEATQRFDCVIIDTSPLSACAD
AQTLGRQSDGILLVTRPDFTIKEVLQRAVSELTHNQIPVMGVVVNGITQQTERYYRYSVN
DYRSLLSR
SITEWalker A526/528GKS
SITEWalker A'546/553LLIDADLR
SITEWalker B626/632VIIDTSP
SITEY Cluster692/700YYRYSVNDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKGLSSLPFILKRRALPALATFIAVIGGAIIYLQITPRLYETSTRLILDQKRVSVSELGRDLTQLSSATPGGSNPLADQ
MEKGLSSLPFILKRRALPALATFIAVIGGAIIYLQITPRLYETSTRLILDQKRVSVSELGRDLTQLSSATPGGSNPLADQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELIKSQRILQKALTKVAAESGFSLPENELTVGQLSQNLKVKIVPATNILEVSYLNKDPTLATRVVNAVSQAMVEDNTQV
AELIKSQRILQKALTKVAAESGFSLPENELTVGQLSQNLKVKIVPATNILEVSYLNKDPTLATRVVNAVSQA        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRQEAANVRKFLEKKVPDARKRVEEAEQKENKYRQSSGIVSFDEQTKSLVNSLAIVEEQENTLVAQLQELRSKEASLRQV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDAKALNQAYAAVRGGQDEELKALRTKLAEIETKLVQARLSLTDSHPTVINMLGQRNGLRALYFQGLARVSPGNTSISSS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVAGDQISQDLTSQLIVNDVERLAVEKRFRSVQAHRANLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAQLVGNIQIIEAAQPPKEPSLPNKKAVLAIATVFGIALATGIVLLLEFMDHTLKDASEAEELLKLPLLGVLPRLPADAI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALEPSGRFLDHVGLVEPYRTLFKNLEFRSTEPLRSIVVSSTVTGEGKSVVASHLAVISAMLSRRTLLIDADLRRPVLHTL
                                      SSTVTGEGKSVVASHLAVISAMLSRRTLLIDADLRRPVLHTL
                                             GKS                 LLIDADLR       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FNLVPQPGITDVIDSERSLEETVQRTHIANLCVLTCGDLYGRPSHLLESEVMKSLMTEATQRFDCVIIDTSPLSACADAQ
FNLVPQPGITDVIDSERSLEETVQRTHIANLCVLTCGDLYGRPSHLLESEVMKSLMTEATQRFDCVIIDTSPLSACADAQ
                                                                 VIIDTSP        
       650       660       670       680       690       700       710    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
TLGRQSDGILLVTRPDFTIKEVLQRAVSELTHNQIPVMGVVVNGITQQTERYYRYSVNDYRSLLSRGLSEGSSA
TLGRQSDGILLVTRPDFTIKEVLQRAVSELTHNQIPVMGVVVNGITQQTERYYRYSVNDYRSLLSR        
                                                   YYRYSVNDY              

© 1998-2019