BYKdb

Annotate results for A0A0M0WZM9

A0A0M0WZM9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M0WZM9
DOMAINcd41/223TSSTAGEGKSTSAANLAVVFAQEGKRVLIVDADMRKPTIHHTFEMYNTSGLSTVLTRQEK
LHEVVQQSFIVGLDVIVSGPTPPNPTDLLDSTTMDILMKEIYRDYDIIIFDAPPLLHIAD
AQILAHKCDGTLLVVDTDVALKDDMLKAKTLLTTARAKVLGVIMNNMALTRDHYYYQYSS
NKK
SITEWalker A48/50GKS
SITEWalker A'68/75LIVDADMR
SITEWalker B148/154IIFDAPP
SITE-142/-145YRDY
SITEY Cluster214/218YYYQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRKLVTVLDENSISSEQFRAIRTNIKFALPDKDLKTILVTSSTAGEGKSTSAANLAVVFAQEGKRVLIVDADMRKPTIH
                                        TSSTAGEGKSTSAANLAVVFAQEGKRVLIVDADMRKPTIH
                                               GKS                 LIVDADMR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HTFEMYNTSGLSTVLTRQEKLHEVVQQSFIVGLDVIVSGPTPPNPTDLLDSTTMDILMKEIYRDYDIIIFDAPPLLHIAD
HTFEMYNTSGLSTVLTRQEKLHEVVQQSFIVGLDVIVSGPTPPNPTDLLDSTTMDILMKEIYRDYDIIIFDAPPLLHIAD
                                                                   IIFDAPP      
       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
AQILAHKCDGTLLVVDTDVALKDDMLKAKTLLTTARAKVLGVIMNNMALTRDHYYYQYSSNKK
AQILAHKCDGTLLVVDTDVALKDDMLKAKTLLTTARAKVLGVIMNNMALTRDHYYYQYSSNKK
                                                     YYYQY     
© 1998-2019