BYKdb

Annotate results for A0A0M1I405

A0A0M1I405 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M1I405
DOMAINtad10/267DTIDLKELLFSLIAQWKLIAVCTLFCLICALLYLRVSPSIYATDAMIQVEDSKSAASQAL
LGELGNIAGGAGQKSPADAEIEILKSRLVLGNVIQNLNLNIQITDTQDTLLHRLFNRDNT
QIDYSHKGVEYKDPTHAFFIQRLDVPEYYLDKPLNLEFKPQTQQFSLSYKDMPVFEGTLN
KENILKDAKGTWQVRIDSQVPFNRTFILRRLSVPTAVKELTQNYAVAEKGKLTGVVGLTY
QGQDPVHITQVLNNILTV
DOMAINcd543/730AGPAPEVGKSFISVNLATILAQSNKRVLLIDADLRRGYLNKYFNVEIKPGLSEYLSDQAS
FDSIIHHSEVTGLDMITRGKSPANPSEMLGSAKFKAFLDEIMQHYDHVLIDTPPVLAVTD
SIIISQYAGVNLITARHNKTQMKELELTVSRFEQAGVKVNGFILNDIQKSSGGYGYNYAY
NYAAAKDD
SITEWalker A550/552GKS
SITEWalker A'570/577LLIDADLR
SITEWalker B650/656VLIDTPP
SITE-580/-584YLNKY
SITE-621/-623GKS
SITEY Cluster716/724YGYNYAYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQNSNTNEDTIDLKELLFSLIAQWKLIAVCTLFCLICALLYLRVSPSIYATDAMIQVEDSKSAASQALLGELGNIAGGA
         DTIDLKELLFSLIAQWKLIAVCTLFCLICALLYLRVSPSIYATDAMIQVEDSKSAASQALLGELGNIAGGA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQKSPADAEIEILKSRLVLGNVIQNLNLNIQITDTQDTLLHRLFNRDNTQIDYSHKGVEYKDPTHAFFIQRLDVPEYYLD
GQKSPADAEIEILKSRLVLGNVIQNLNLNIQITDTQDTLLHRLFNRDNTQIDYSHKGVEYKDPTHAFFIQRLDVPEYYLD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPLNLEFKPQTQQFSLSYKDMPVFEGTLNKENILKDAKGTWQVRIDSQVPFNRTFILRRLSVPTAVKELTQNYAVAEKGK
KPLNLEFKPQTQQFSLSYKDMPVFEGTLNKENILKDAKGTWQVRIDSQVPFNRTFILRRLSVPTAVKELTQNYAVAEKGK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTGVVGLTYQGQDPVHITQVLNNILTVYHAQNIERKSLEAQQTLSFLDKQLPELKKQLEESELKFNKFREQYNTVDVTQE
LTGVVGLTYQGQDPVHITQVLNNILTV                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SELFLKQNIALETTKIELKQKQAELAAKYTSDHPLMAEINAQLDAVNKKSAELNATIKRLPELQRQYLQYYRDVKVNTEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YTNLLNNYQQLKVANAGEIGNVRVIDTAIEPVKPIKPKKLIVLILSLFVGGFIGVLIALMRKMLRTGIKDSAQIENELDL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVYATVPRSPIQESRIKLLKKNKSIPILSIKNSDDIAIESLRSMRTAIHFALANAKNNLIMIAGPAPEVGKSFISVNLAT
                                                              AGPAPEVGKSFISVNLAT
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILAQSNKRVLLIDADLRRGYLNKYFNVEIKPGLSEYLSDQASFDSIIHHSEVTGLDMITRGKSPANPSEMLGSAKFKAFL
ILAQSNKRVLLIDADLRRGYLNKYFNVEIKPGLSEYLSDQASFDSIIHHSEVTGLDMITRGKSPANPSEMLGSAKFKAFL
         LLIDADLR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEIMQHYDHVLIDTPPVLAVTDSIIISQYAGVNLITARHNKTQMKELELTVSRFEQAGVKVNGFILNDIQKSSGGYGYNY
DEIMQHYDHVLIDTPPVLAVTDSIIISQYAGVNLITARHNKTQMKELELTVSRFEQAGVKVNGFILNDIQKSSGGYGYNY
         VLIDTPP                                                           YGYNY
       730
....:....|
AYNYAAAKDD
AYNYAAAKDD
AYNY      

© 1998-2019