BYKdb

Annotate results for A0A0M1JB65

A0A0M1JB65 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M1JB65
DOMAINtad34/227DKVNILELFRIISRYKVGILSLAFLVTILSVLVALSMIPTYKSTATLMVEVRKPNVVAIQ
QIGITDLSADSQYYQTQVRIITSRKLLDEVIAQLQLDKKLGQNTTQNNQPPQFPLVNWQS
FVPDWRAWLPEDLFPGIKAMEIQQTPEVMANIVRSRLNNGLTVTYVKNTKLIEVSFESPN
RKLAATISNAIAKT
DOMAINcd569/758TSSVQKEGKSSTAATTAYFLAEIHKTLLIDCDLRKPIQKNLFGIAKNHPGLSDLMLGNVN
IDDCLVKIDDRNLSVLCAGSRTPNPLDVLSSNRFSEIIQQVIETFDYVVLDCAPVMSVSD
GLLLSTMVDGVVFVVQADQTTYAVAMEAVKRLRHVNAHIIGVVLNKLPQSKIGGYYGKYG
YGKYGYYADV
SITEWalker A576/578GKS
SITEWalker A'595/602LLIDCDLR
SITEWalker B676/682VVLDCAP
SITEY Cluster743/759YYGKYGYGKYGYYADVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTTKTLTITKSLPTTSGTGLQIEKSNLLQNVDEDKVNILELFRIISRYKVGILSLAFLVTILSVLVALSMIPTYKSTATL
                                 DKVNILELFRIISRYKVGILSLAFLVTILSVLVALSMIPTYKSTATL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVEVRKPNVVAIQQIGITDLSADSQYYQTQVRIITSRKLLDEVIAQLQLDKKLGQNTTQNNQPPQFPLVNWQSFVPDWRA
MVEVRKPNVVAIQQIGITDLSADSQYYQTQVRIITSRKLLDEVIAQLQLDKKLGQNTTQNNQPPQFPLVNWQSFVPDWRA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WLPEDLFPGIKAMEIQQTPEVMANIVRSRLNNGLTVTYVKNTKLIEVSFESPNRKLAATISNAIAKTYIENDIKAQQEMA
WLPEDLFPGIKAMEIQQTPEVMANIVRSRLNNGLTVTYVKNTKLIEVSFESPNRKLAATISNAIAKT             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANATSWLRKHVEELRIRLKQSEQELQRFREKERLLDVGGVKTIGAEQLSGFSAQLIEAQQQLAEVSASYKQIATARRRNR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LESIPAVLSDSLVTSLQQAKATAQRKVASFIKRYGPRHPKMVAAQADLEEARARIHARIQEVLAGVEKKYRAAKAKVESL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQIVQQNKSEMQQINRKGYRLGALEREVESNRQIYKTFLDRFKETSTTSNLYYASARLVEEAIPAITPHSPNIKVVTSIA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATIGLFIGLLWVSILVRLDQTFKGPEDVEERLDLSTLGILPLLRKVKKKNVLNQVSKEPNGLFAESLRTVRTGLLLSDLN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPHKVILITSSVQKEGKSSTAATTAYFLAEIHKTLLIDCDLRKPIQKNLFGIAKNHPGLSDLMLGNVNIDDCLVKIDDRN
        TSSVQKEGKSSTAATTAYFLAEIHKTLLIDCDLRKPIQKNLFGIAKNHPGLSDLMLGNVNIDDCLVKIDDRN
               GKS                LLIDCDLR                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSVLCAGSRTPNPLDVLSSNRFSEIIQQVIETFDYVVLDCAPVMSVSDGLLLSTMVDGVVFVVQADQTTYAVAMEAVKRL
LSVLCAGSRTPNPLDVLSSNRFSEIIQQVIETFDYVVLDCAPVMSVSDGLLLSTMVDGVVFVVQADQTTYAVAMEAVKRL
                                   VVLDCAP                                      
       730       740       750         
....:....|....:....|....:....|....:....
RHVNAHIIGVVLNKLPQSKIGGYYGKYGYGKYGYYADVY
RHVNAHIIGVVLNKLPQSKIGGYYGKYGYGKYGYYADV 
                      YYGKYGYGKYGYYADVY

© 1998-2019