BYKdb

Annotate results for A0A0M1NZ20

A0A0M1NZ20 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M1NZ20
DOMAINcd50/228TSSEPNDGKSTTAANLAIVLAQEEKKVLLVDADLRKPSVHYAFNLSNIHGLTSVLTKKMD
LRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIEIAINELKEMYDYIIFDTPPVLVVPD
SQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSNYYYYQS
SITE-187/-189GKT
SITEWalker A'77/84LLVDADLR
SITEWalker B157/163IIFDTPP
SITE-154/-156YDY
SITEY Cluster223/226YYYY
SITEWalker A57/59GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGFLRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQEEKKVLLVD
                                                 TSSEPNDGKSTTAANLAIVLAQEEKKVLLVD
                                                        GKS                 LLVD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRKPSVHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIEIAINELKEMYDYIIFD
ADLRKPSVHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIEIAINELKEMYDYIIFD
ADLR                                                                        IIFD
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
TPPVLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSNYYYYQS
TPPVLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSNYYYYQS
TPP                                                           YYYY  
© 1998-2019