BYKdb

Annotate results for A0A0M1X983

A0A0M1X983 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M1X983
DOMAINcd54/232TSSGPGEGKSTTAANIAVVFAKSGQRVLLVDADLRKPVVYKTFQLNNASGLSTALSSSGS
VADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQVLAEARQLFDVVIFDMPPVVAVTD
AQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
SITEWalker A61/63GKS
SITEWalker A'81/88LLVDADLR
SITEWalker B161/167VIFDMPP
SITEY Cluster228/230YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARTQKQKATQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
                                                     TSSGPGEGKSTTAANIAVVFAKSGQRV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVDADLRKPVVYKTFQLNNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQVLAEARQLFDV
LLVDADLRKPVVYKTFQLNNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQVLAEARQLFDV
LLVDADLR                                                                        
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
VIFDMPP                                                            YYY  
© 1998-2019