BYKdb

Annotate results for A0A0M2SM41

A0A0M2SM41 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M2SM41
DOMAINcd53/238TSAVAGAGKSTIAANVAIAYAQAGKKTLLLDGDLRRPTCHYTFKVSNQKGLSTAIVNDIA
SEDLVNQTEFDNLYLITSGPIPPNPSELLSSKKLTQFIDHLKFQYEMIIVDSPPLLSVTD
AQLLSKSADGVIMITDVENNNRNHLLEAKDLLNKADANIIGLVLNNRDAKYRLKDDYYYH
QASHDG
SITEWalker A60/62GKS
SITEWalker A'80/87LLLDGDLR
SITEWalker B160/166IIVDSPP
SITEY Cluster223/231YRLKDDYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMRHRKMNNEVASAKKIIVATKPHSPVSEQFRTIRTNIMYSSIDRPIRSVLFTSAVAGAGKSTIAANVAIAYAQAGKKTL
                                                    TSAVAGAGKSTIAANVAIAYAQAGKKTL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLDGDLRRPTCHYTFKVSNQKGLSTAIVNDIASEDLVNQTEFDNLYLITSGPIPPNPSELLSSKKLTQFIDHLKFQYEMI
LLDGDLRRPTCHYTFKVSNQKGLSTAIVNDIASEDLVNQTEFDNLYLITSGPIPPNPSELLSSKKLTQFIDHLKFQYEMI
LLDGDLR                                                                        I
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
IVDSPPLLSVTDAQLLSKSADGVIMITDVENNNRNHLLEAKDLLNKADANIIGLVLNNRDAKYRLKDDYYYHQASHDG
IVDSPPLLSVTDAQLLSKSADGVIMITDVENNNRNHLLEAKDLLNKADANIIGLVLNNRDAKYRLKDDYYYHQASHDG
IVDSPP                                                        YRLKDDYYY       
© 1998-2019