BYKdb

Annotate results for A0A0M2SQ00

A0A0M2SQ00 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M2SQ00
DOMAINcd51/229TSADPAEGKSTTAANLAIVMAQKGKKTILVDADLRKPTVHYSFTVSNMEGLTSVLAKEIS
LEDTVLRTNVPNLDIITSGPIPPNPAELLDSKAMELLMGELKEMYEYIVIDSPPILAVTD
PQIMATKCDGVVLVVASGKTQKDRAVKAKELLERSGAKIIGVVVNGVEEKLEGYYGHYR
SITE-188/-190GKT
SITEWalker A'78/85ILVDADLR
SITEWalker B158/164IVIDSPP
SITE-155/-157YEY
SITEY Cluster224/228YYGHY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRKTKRRQKNPVSLIAHTNPIAPITEQYRLIRNNIHYSSVDKIIKTVFVTSADPAEGKSTTAANLAIVMAQKGKKTILV
                                                  TSADPAEGKSTTAANLAIVMAQKGKKTILV
                                                         GKS                 ILV
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRKPTVHYSFTVSNMEGLTSVLAKEISLEDTVLRTNVPNLDIITSGPIPPNPAELLDSKAMELLMGELKEMYEYIVI
DADLRKPTVHYSFTVSNMEGLTSVLAKEISLEDTVLRTNVPNLDIITSGPIPPNPAELLDSKAMELLMGELKEMYEYIVI
DADLR                                                                        IVI
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
DSPPILAVTDPQIMATKCDGVVLVVASGKTQKDRAVKAKELLERSGAKIIGVVVNGVEEKLEGYYGHYR
DSPPILAVTDPQIMATKCDGVVLVVASGKTQKDRAVKAKELLERSGAKIIGVVVNGVEEKLEGYYGHYR
DSPP                                                           YYGHY 
© 1998-2019