BYKdb

Annotate results for A0A0M2T0F1

A0A0M2T0F1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M2T0F1
DOMAINcd53/232SSAGPGEGKSTTAANLAVTFAQQEKRVLLVDADLRKPTVHYTFNLANHYGLTSILTNGKA
LDEAISPTGIENLSVLTSGPIPPNPAELLGSKKMKQLLQQVKEEFDVVIFDTPPALAVTD
GQILANSCDGIVLVLYSGKTEVDQVTKAKNLLAAANGRILGVVLNHKKIQGSNYYYYYGS
SITE-190/-192GKT
SITEWalker A'80/87LLVDADLR
SITEWalker B160/166VIFDTPP
SITEY Cluster226/230YYYYY
SITEWalker A60/62GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVFSFRKKAAPSNKRKLIAVEDAKSPISEQYRTIRTNIQFTAVDESIKTIMISSAGPGEGKSTTAANLAVTFAQQEKRVL
                                                    SSAGPGEGKSTTAANLAVTFAQQEKRVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDADLRKPTVHYTFNLANHYGLTSILTNGKALDEAISPTGIENLSVLTSGPIPPNPAELLGSKKMKQLLQQVKEEFDVV
LVDADLRKPTVHYTFNLANHYGLTSILTNGKALDEAISPTGIENLSVLTSGPIPPNPAELLGSKKMKQLLQQVKEEFDVV
LVDADLR                                                                        V
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
IFDTPPALAVTDGQILANSCDGIVLVLYSGKTEVDQVTKAKNLLAAANGRILGVVLNHKKIQGSNYYYYYGS
IFDTPPALAVTDGQILANSCDGIVLVLYSGKTEVDQVTKAKNLLAAANGRILGVVLNHKKIQGSNYYYYYGS
IFDTPP                                                           YYYYY  
© 1998-2019