BYKdb

Annotate results for A0A0M2U580

A0A0M2U580 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M2U580
DOMAINcd44/231TSAGPGEGKSLTAANLAVVMAQSGKETLLVDCDLRKPMQHRLFGLRNNRGLTSLLVQGGD
PGTVTQQTEVAHLNIITSGLIPPNPAELLGSQAMKPLVQELKSRYATVIIDGPPLIAVTD
AALLAPRVDGVLLVIRAGEARIDMVQEAKSIIENAGARVIGCVLNGVRRKSKDYHYYYYY
AEKSGTDD
SITEWalker A51/53GKS
SITEWalker A'71/78LLVDCDLR
SITEWalker B151/157VIIDGPP
SITEY Cluster217/223YHYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRSLQQTIAYHEPKSPATEAYRTLRTNIQYASVDHPVNSLLITSAGPGEGKSLTAANLAVVMAQSGKETLLVDCDLRKP
                                           TSAGPGEGKSLTAANLAVVMAQSGKETLLVDCDLRKP
                                                  GKS                 LLVDCDLR  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQHRLFGLRNNRGLTSLLVQGGDPGTVTQQTEVAHLNIITSGLIPPNPAELLGSQAMKPLVQELKSRYATVIIDGPPLIA
MQHRLFGLRNNRGLTSLLVQGGDPGTVTQQTEVAHLNIITSGLIPPNPAELLGSQAMKPLVQELKSRYATVIIDGPPLIA
                                                                      VIIDGPP   
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
VTDAALLAPRVDGVLLVIRAGEARIDMVQEAKSIIENAGARVIGCVLNGVRRKSKDYHYYYYYAEKSGTDD
VTDAALLAPRVDGVLLVIRAGEARIDMVQEAKSIIENAGARVIGCVLNGVRRKSKDYHYYYYYAEKSGTDD
                                                        YHYYYYY        
© 1998-2019