BYKdb

Annotate results for A0A0M2V8R3

A0A0M2V8R3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M2V8R3
DOMAINtad16/194QVIDLKKTINVIYRAKWRIMAFTLLCGALATFVLLNMAPVYRATSTLLLEANQARAIKIE
EVYGFNSSQQEYYLTQFEVLKSRSIAEQVFKQLNVASHFEYQPKPGWKQQLVALLPFLPQ
KAPVADPDYAAFLLHKRQLDAFVRNVQITPVRRTQLVRLSFSSEDPRLAQAVADALGEA
DOMAINcd539/726TSSYPEEGKTSVSLNLAYAYAALERVLVIDADMRKPTLGSKLGLPSYQSGLANVLSGTEK
LADCIVRDEQSGVDVLAAGAVPLNPLELLAGGAFEALLNTLRADYDKIIIDTPPVQLVSD
SLLLAPMSDAVLLVVKADHTRSPALKNSIAKINQAHGNLYGVVLNQMDTEKAASYYGQYG
QYGYYGAE
SITEWalker A546/548GKT
SITEWalker A'565/572LVIDADMR
SITEWalker B646/652IIIDTPP
SITE-556/-558YAY
SITEY Cluster713/723YYGQYGQYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQVDITRVDSASQAIQVIDLKKTINVIYRAKWRIMAFTLLCGALATFVLLNMAPVYRATSTLLLEANQARAIKIEEVYGF
               QVIDLKKTINVIYRAKWRIMAFTLLCGALATFVLLNMAPVYRATSTLLLEANQARAIKIEEVYGF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSSQQEYYLTQFEVLKSRSIAEQVFKQLNVASHFEYQPKPGWKQQLVALLPFLPQKAPVADPDYAAFLLHKRQLDAFVRN
NSSQQEYYLTQFEVLKSRSIAEQVFKQLNVASHFEYQPKPGWKQQLVALLPFLPQKAPVADPDYAAFLLHKRQLDAFVRN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQITPVRRTQLVRLSFSSEDPRLAQAVADALGEAYINSQLDARLGMTQKASSWLGGRVTELRDKLEQSEFKLEQFRATHN
VQITPVRRTQLVRLSFSSEDPRLAQAVADALGEA                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDVAGVTALDQRELERLNEQLSVARARKAETEGFLNLVQRFGRDDIRRLESLPEITSHISIQNVKREVLVTERKVSELA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVYGPKHPRMISAQAELQSVQQNLTQQILRLIDGVEKEAQATAERLTALEQRFALARSRFSGLGSLESDYRRLEREVEAN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLLFDNFMARQKETEVTGGFDAPIARFTDLATLPTVPEKPNKRLILLLVLIAASGVAIVMALVLDALNDTIKHLPDVEKM


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNQRALGFLPRSTKKATELVRARAYFDRSQRQHIEAVSNIRTSLSLLAIDKSLQIIEVTSSYPEEGKTSVSLNLAYAYAA
                                                          TSSYPEEGKTSVSLNLAYAYAA
                                                                 GKT            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LERVLVIDADMRKPTLGSKLGLPSYQSGLANVLSGTEKLADCIVRDEQSGVDVLAAGAVPLNPLELLAGGAFEALLNTLR
LERVLVIDADMRKPTLGSKLGLPSYQSGLANVLSGTEKLADCIVRDEQSGVDVLAAGAVPLNPLELLAGGAFEALLNTLR
    LVIDADMR                                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADYDKIIIDTPPVQLVSDSLLLAPMSDAVLLVVKADHTRSPALKNSIAKINQAHGNLYGVVLNQMDTEKAASYYGQYGQY
ADYDKIIIDTPPVQLVSDSLLLAPMSDAVLLVVKADHTRSPALKNSIAKINQAHGNLYGVVLNQMDTEKAASYYGQYGQY
     IIIDTPP                                                            YYGQYGQY
        
....:...
GYYGAEQA
GYYGAE  
GYY     

© 1998-2019