BYKdb

Annotate results for A0A0M3AWD8

A0A0M3AWD8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M3AWD8
DOMAINtad24/193FAAAANGAWVAVRRHRIILFVTMALCVLAGVVFILLSTPDYRATASVEVEDIPAGAAGAA
AAQRQATPSDNEALMQTELEVLRSRALAEDVARELALVGSRTFFDGMDVRRPDRGAGSLS
QRQVETEMVVNLLRDNLHVELPGKSRVIRISFTSADPILSARVANSYADS
DOMAINcd525/704TSAQEGEGKSSTLHALAKALAKLDKRVLVIDADMRRPKQHSLFGIAPHRGISELMTGQAK
MDEVIVDSGVPGVSLLPCGAIPPSPAELLITPAMDSLLAAVRERYDTVLIDAPPILGLSD
ASLLAAKAQVTLLVVEWGRNHHGGLRVAADRLRRAGGAIIGAILTKQQGRAFEYDYHRGG
SITEWalker A532/534GKS
SITEWalker A'552/559LVIDADMR
SITEWalker B632/638VLIDAPP
SITEY Cluster698/700YDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAGPGLLIDADGASATMEGRAARFAAAANGAWVAVRRHRIILFVTMALCVLAGVVFILLSTPDYRATASVEVEDIPAGAA
                       FAAAANGAWVAVRRHRIILFVTMALCVLAGVVFILLSTPDYRATASVEVEDIPAGAA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAAAAQRQATPSDNEALMQTELEVLRSRALAEDVARELALVGSRTFFDGMDVRRPDRGAGSLSQRQVETEMVVNLLRDNL
GAAAAQRQATPSDNEALMQTELEVLRSRALAEDVARELALVGSRTFFDGMDVRRPDRGAGSLSQRQVETEMVVNLLRDNL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HVELPGKSRVIRISFTSADPILSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYAANAGA
HVELPGKSRVIRISFTSADPILSARVANSYADS                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAPLGTQEGEGGDSPPEGTTATRLAQLNAFRAQATADRIAAQKRWESARLSSVETLPEVLNNGAMQQIMTERAQARAQVV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QERQFRKDAHPEMREARARLAALDDQAEGMANTIRASLKEQFDVAVHGEKQIRSEIAKVERQAQAERGRGVQMSILERQV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTYRLLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPSRPSSPNIGVTMLLASLGGLVLGLLAVAGRHIFDDAVTSADTL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AERVNLPLLGAVPAGEKPATEIFAPIASSLLLGSAAGLPRSILVTSAQEGEGKSSTLHALAKALAKLDKRVLVIDADMRR
                                            TSAQEGEGKSSTLHALAKALAKLDKRVLVIDADMRR
                                                   GKS                 LVIDADMR 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PKQHSLFGIAPHRGISELMTGQAKMDEVIVDSGVPGVSLLPCGAIPPSPAELLITPAMDSLLAAVRERYDTVLIDAPPIL
PKQHSLFGIAPHRGISELMTGQAKMDEVIVDSGVPGVSLLPCGAIPPSPAELLITPAMDSLLAAVRERYDTVLIDAPPIL
                                                                       VLIDAPP  
       650       660       670       680       690       700    
....:....|....:....|....:....|....:....|....:....|....:....|....
GLSDASLLAAKAQVTLLVVEWGRNHHGGLRVAADRLRRAGGAIIGAILTKQQGRAFEYDYHRGG
GLSDASLLAAKAQVTLLVVEWGRNHHGGLRVAADRLRRAGGAIIGAILTKQQGRAFEYDYHRGG
                                                         YDY    

© 1998-2019