BYKdb

Annotate results for A0A0M3DGN7

A0A0M3DGN7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M3DGN7
DOMAINcd51/240TSSKQDEGKTTVSSNLAVSFASLEGKKVLLIDADLRNPSVHKMFTKPNALGLTDVLAGKK
ELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIFIDTPPIGIIM
DAGVLANYADGTILVVGAKDVETERAKISKERLEKVKANVIGAVLNKYIEKNGSYGYYSY
YYEQSDSSRV
SITEWalker A58/60GKT
SITEWalker A'79/86LLIDADLR
SITEWalker B159/165IFIDTPP
SITE-155/-158YYDY
SITEY Cluster225/232YGYYSYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKIKVRKVVNKMINITTFNDPKSPIAESYRSIRTNIQFSKLDNEMKTIVITSSKQDEGKTTVSSNLAVSFASLEGKKVLL
                                                  TSSKQDEGKTTVSSNLAVSFASLEGKKVLL
                                                         GKT                  LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADLRNPSVHKMFTKPNALGLTDVLAGKKELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIF
IDADLRNPSVHKMFTKPNALGLTDVLAGKKELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIF
IDADLR                                                                        IF
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDTPPIGIIMDAGVLANYADGTILVVGAKDVETERAKISKERLEKVKANVIGAVLNKYIEKNGSYGYYSYYYEQSDSSRV
IDTPPIGIIMDAGVLANYADGTILVVGAKDVETERAKISKERLEKVKANVIGAVLNKYIEKNGSYGYYSYYYEQSDSSRV
IDTPP                                                           YGYYSYYY        
        
....:...
SKKKKKKH


© 1998-2019