BYKdb

Annotate results for A0A0M3GBT1

A0A0M3GBT1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M3GBT1
DOMAINcd457/642TSAHSGEGKSLIARSLAIELAAAAIPVLLVDGDLRRGELESYFKSGLRQGLNEFLNGHAD
IRDVVDHHPSGIDFIPSGKFSLQRRVRSNGLAEIIEMAGAAGRIVIFDSAPVLASTDTVL
LTALAEKTLAVVRWGKTSRRAVEFGLQQMKSPRNSEIIVAINRVNPEKHALYNFSDSELF
SRSLMK
SITE-591/-593GKT
SITEWalker A'484/491LLVDGDLR
SITEWalker B561/567VIFDSAP
SITEY Cluster643/644YY
SITEWalker A464/466GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEDKSSSSDLLDAKSETERLLSRSIAERVVRELQLNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAVIP


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFYRALGVWHEDKSDVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSVRSRLDAAEKWIVQRISEQKARADTAREAARSY


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QESMDVISKEDAQDERLKSLIELTGREGKIEETRVEVKAVISTLEAADSASVAVQNIALPDDITSKQRDLHAQEDDLARL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LELYDGNAEAVVDLRGKIEKSRADLSFATKQYLQTMRAKLAALDHEAAAVQSILDVAHEKRARDALVQTELTRLQRISDK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQTALEKLEDQRRDLADKAKLPGAELEVLSPASVPLAAQGRGRLFYLVSALLAAISAAVTAAFVMEMWDRSIRSFDQIAG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARTIPAGLIPRLARRENPKTIFGQVRVPMFDEAIRTVILTLKQSNGGKLPNSIVVTSAHSGEGKSLIARSLAIELAAAA
                                                        TSAHSGEGKSLIARSLAIELAAAA
                                                               GKS              
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IPVLLVDGDLRRGELESYFKSGLRQGLNEFLNGHADIRDVVDHHPSGIDFIPSGKFSLQRRVRSNGLAEIIEMAGAAGRI
IPVLLVDGDLRRGELESYFKSGLRQGLNEFLNGHADIRDVVDHHPSGIDFIPSGKFSLQRRVRSNGLAEIIEMAGAAGRI
   LLVDGDLR                                                                     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIFDSAPVLASTDTVLLTALAEKTLAVVRWGKTSRRAVEFGLQQMKSPRNSEIIVAINRVNPEKHALYNFSDSELFSRSL
VIFDSAPVLASTDTVLLTALAEKTLAVVRWGKTSRRAVEFGLQQMKSPRNSEIIVAINRVNPEKHALYNFSDSELFSRSL
VIFDSAP                                                                         
        
....:...
MKYYNFKE
MK      
  YY    
© 1998-2019