BYKdb

Annotate results for A0A0M3RB28

A0A0M3RB28 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M3RB28
DOMAINcd45/221TSAHSSEGKSFIAANLAVVFAQQEKKVLLIDGDLRKPTNHGLFQLDNSIGLTNVLMRQRT
LENAVQASTVENLDLLTSGPTPPNPAELLSSRAMEDLLVQAYDRYSLVIFDSPPILAVAD
AQILANQTDGSILVIASSKTKNEDAKKAKDALEASKGKLLGALLNNKKMRKNELYVY
SITEWalker A52/54GKS
SITEWalker A'72/79LLIDGDLR
SITEWalker B152/158VIFDSPP
SITE-146/-149YDRY
SITEY Cluster219/221YVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTKDNPRSIIAMFQPKSPIVEQFRTIRTNIEFSSMEDHIRSILVTSAHSSEGKSFIAANLAVVFAQQEKKVLLIDGDLRK
                                            TSAHSSEGKSFIAANLAVVFAQQEKKVLLIDGDLRK
                                                   GKS                 LLIDGDLR 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTNHGLFQLDNSIGLTNVLMRQRTLENAVQASTVENLDLLTSGPTPPNPAELLSSRAMEDLLVQAYDRYSLVIFDSPPIL
PTNHGLFQLDNSIGLTNVLMRQRTLENAVQASTVENLDLLTSGPTPPNPAELLSSRAMEDLLVQAYDRYSLVIFDSPPIL
                                                                       VIFDSPP  
       170       180       190       200       210       220 
....:....|....:....|....:....|....:....|....:....|....:....|.
AVADAQILANQTDGSILVIASSKTKNEDAKKAKDALEASKGKLLGALLNNKKMRKNELYVY
AVADAQILANQTDGSILVIASSKTKNEDAKKAKDALEASKGKLLGALLNNKKMRKNELYVY
                                                          YVY
© 1998-2019