BYKdb

Annotate results for A0A0M3RB32

A0A0M3RB32 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M3RB32
DOMAINcd33/213TSSGPGEGKSTTAANLAVVFAQQGKRVLLIDSDLRKPTVQYTFQLDNTDGLTTVLLKQMS
LKTIVQKCMVDNLDILTSGPIPPNPAELLSSKSMGKLLEDAYKIYDIIIFDSPPVLAVTD
AQILANHTDGSLLVVSSGKTEKELAVKAKEVLSSTKSKLLGAVLNGKKLEQSSYYYYYGG
K
SITE-170/-172GKT
SITEWalker A'60/67LLIDSDLR
SITEWalker B140/146IIFDSPP
SITE-134/-137YKIY
SITEY Cluster206/210YYYYY
SITEWalker A40/42GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEPKSPSSEQYRTIRTNIEFSSVDKNVRSILITSSGPGEGKSTTAANLAVVFAQQGKRVLLIDSDLRKPTVQYTFQLDNT
                                TSSGPGEGKSTTAANLAVVFAQQGKRVLLIDSDLRKPTVQYTFQLDNT
                                       GKS                 LLIDSDLR             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGLTTVLLKQMSLKTIVQKCMVDNLDILTSGPIPPNPAELLSSKSMGKLLEDAYKIYDIIIFDSPPVLAVTDAQILANHT
DGLTTVLLKQMSLKTIVQKCMVDNLDILTSGPIPPNPAELLSSKSMGKLLEDAYKIYDIIIFDSPPVLAVTDAQILANHT
                                                           IIFDSPP              
       170       180       190       200       210   
....:....|....:....|....:....|....:....|....:....|...
DGSLLVVSSGKTEKELAVKAKEVLSSTKSKLLGAVLNGKKLEQSSYYYYYGGK
DGSLLVVSSGKTEKELAVKAKEVLSSTKSKLLGAVLNGKKLEQSSYYYYYGGK
                                             YYYYY   
© 1998-2019