BYKdb

Annotate results for A0A0M3T8W0

A0A0M3T8W0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M3T8W0
DOMAINtad1/139MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTN
DMSSGANYLNTQIKTYPELVKTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDIS
AEVGDPQQAADIANSVAKN
DOMAINcd275/462TSTDPSEGKTTVSANVAVALAEEGKSVLLIDADLRHPSVAHKLGIEGHVGLSHVLSRQAS
PADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVAGD
ATVFGRMAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYY
YYEDGNKR
SITEWalker A282/284GKT
SITEWalker A'302/309LLIDADLR
SITEWalker B382/388VIIDTAP
SITE-379/-381YDY
SITE-298/-300GKS
SITEY Cluster451/456YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKN                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTVVQSAQTPTGQSSPNIPLYLAMGLILGLIVGIGVALLKDILNPKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSANVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
                                  TSTDPSEGKTTVSANVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
                                         GKT                 LLIDADLR           
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVAGDATVFGR
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVAGDATVFGR
                                                             VIIDTAP            
       410       420       430       440       450       460       470        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKR                
                                                  YYYYYY                      
© 1998-2019