BYKdb

Annotate results for A0A0M3T9R6

A0A0M3T9R6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M3T9R6
DOMAINtad33/202RALTLPALKGFLYRQRYVMAVTFALVILAALFATLLMTPIYKAASTVRIEPYGNNIVEGQ
DLAPVVPANEIGRYFITLGNVVESRNLAYRVADSLKLTERAGFLPEGMDGAKPNGADERA
WERQKRETVVDMLQGGVTAIVPFDSRIMSIEYRSPDPVLAAEIANAYADN
DOMAINcd545/736TSSQASEGKSTTSMVVANQFAQLGYRTLLVDADLRRPGLSKLIADKRPEKGFADVLKGEA
ALADVQLQGTAERLTVLPGGKAPDNPVELLSSDLLTKFLDEQGEHFDRIIFDSSPVMGIA
DAPLLSRHVDATVFVLEANAIDQSQARTAIRRLLHAGAYIPGIVMTKYRALLAGQYYGYE
YQYYTYREAAPA
SITEWalker A552/554GKS
SITEWalker A'572/579LLVDADLR
SITEWalker B653/659IIFDSSP
SITEY Cluster720/730YYGYEYQYYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNEAKHIGPGGGKSEFWLDRFLPNSNADGGQNRALTLPALKGFLYRQRYVMAVTFALVILAALFATLLMTPIYKAASTVR
                                RALTLPALKGFLYRQRYVMAVTFALVILAALFATLLMTPIYKAASTVR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEPYGNNIVEGQDLAPVVPANEIGRYFITLGNVVESRNLAYRVADSLKLTERAGFLPEGMDGAKPNGADERAWERQKRET
IEPYGNNIVEGQDLAPVVPANEIGRYFITLGNVVESRNLAYRVADSLKLTERAGFLPEGMDGAKPNGADERAWERQKRET

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVDMLQGGVTAIVPFDSRIMSIEYRSPDPVLAAEIANAYADNFVLDDMRRSLDANAYAQDYLQEQIADVRGKLQDAELAA
VVDMLQGGVTAIVPFDSRIMSIEYRSPDPVLAAEIANAYADN                                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAYARKSGIVKPLATGGIDEAESEAATITASNLISINQNYTDARARRIAAEQRWRTVSGLPAAQLPGVQQSQVVQALVEQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSTKAAELVDLQQRYDDNYPTVVEARAQIAELDRQIARTGSEIKASVRNEYDIARRQEQALAAEMKNVTGESLAEQDRRV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYNLLDREARALRGQLASLLARFNEISTAANVKEGSITKLDAAIVPTVPVTPNLWRNMLAAIAIGLASAFGLAILREIFD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRLRTLEEVEERLGLPLLGHTPFIENENLREEIAQPFSALSESYASIVSSIEHALPADSRVLQFTSSQASEGKSTTSMVV
                                                                TSSQASEGKSTTSMVV
                                                                       GKS      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANQFAQLGYRTLLVDADLRRPGLSKLIADKRPEKGFADVLKGEAALADVQLQGTAERLTVLPGGKAPDNPVELLSSDLLT
ANQFAQLGYRTLLVDADLRRPGLSKLIADKRPEKGFADVLKGEAALADVQLQGTAERLTVLPGGKAPDNPVELLSSDLLT
           LLVDADLR                                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KFLDEQGEHFDRIIFDSSPVMGIADAPLLSRHVDATVFVLEANAIDQSQARTAIRRLLHAGAYIPGIVMTKYRALLAGQY
KFLDEQGEHFDRIIFDSSPVMGIADAPLLSRHVDATVFVLEANAIDQSQARTAIRRLLHAGAYIPGIVMTKYRALLAGQY
            IIFDSSP                                                            Y
       730      
....:....|....:.
YGYEYQYYTYREAAPA
YGYEYQYYTYREAAPA
YGYEYQYYTY      

© 1998-2019