BYKdb

Annotate results for A0A0M3UE18

A0A0M3UE18 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M3UE18
DOMAINtad17/272DDIDLMGLLGTLLDHKWLIAGVTGAFMAAGVAYALLATPVYQANALIQVEAKKNDPLGFS
DIGSMLGKESPSATEIELIKSRTNIGAAIDNLQLDIEVEPNYFPLIGEFIARRFTPSAEN
NVASPLLGMNSFAWGGEQLKLAQLELPKELLGEELSLVTGEAGSFSLFDEDNNLLIKGQV
GQSYSQNGISIQVEVLKANPGTTFSVTRYPRLTTILRYQKVLDVSERGKESGMIGIALES
EEPDIAINTLNEIARL
DOMAINcd551/741SGPSPKVGKSFVSANLAAVIAQSGQRVLLVDVDMRKGYIHKMFGIPVDNGLSDLLAKRCD
LDTATHKTDIENLDVIGRGQVPPNPSELLMHKNFSEFLDQISARYDQVILDTPPFLAVTD
AAIVGRQSGTNLIVTRFELNPAREVELTMRRFAQNGIELKGAIFNGVEKRASAKYGYGAY
GYYNYEYKSDS
SITEWalker A558/560GKS
SITEWalker A'578/585LLVDVDMR
SITEWalker B658/664VILDTPP
SITEY Cluster725/737YGYGAYGYYNYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQQAPVTKPHDQEDDSDDIDLMGLLGTLLDHKWLIAGVTGAFMAAGVAYALLATPVYQANALIQVEAKKNDPLGFSDIGS
                DDIDLMGLLGTLLDHKWLIAGVTGAFMAAGVAYALLATPVYQANALIQVEAKKNDPLGFSDIGS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLGKESPSATEIELIKSRTNIGAAIDNLQLDIEVEPNYFPLIGEFIARRFTPSAENNVASPLLGMNSFAWGGEQLKLAQL
MLGKESPSATEIELIKSRTNIGAAIDNLQLDIEVEPNYFPLIGEFIARRFTPSAENNVASPLLGMNSFAWGGEQLKLAQL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELPKELLGEELSLVTGEAGSFSLFDEDNNLLIKGQVGQSYSQNGISIQVEVLKANPGTTFSVTRYPRLTTILRYQKVLDV
ELPKELLGEELSLVTGEAGSFSLFDEDNNLLIKGQVGQSYSQNGISIQVEVLKANPGTTFSVTRYPRLTTILRYQKVLDV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SERGKESGMIGIALESEEPDIAINTLNEIARLYVQQNIERTSAEAAQSLGFLKDQIPQVRKDLEKAENALNQFQIRSKSI
SERGKESGMIGIALESEEPDIAINTLNEIARL                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DISLEAKAILDQIVALDTSISTLKLQQAEMDRKFTPQHPAYRALMGQLAELTGKQQRLAKQVEGLPTTQQELLSLTRDLK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSTEIYTQLLNKSQELDVMRAGAVGNVRLIDTADVDLRNPVKPKKALIVLMATLLGAFLAIGYVLFRKALNRGVQNPDDI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKLGLPVYASIPFSSLQKVEDEKSPGGRGTRITPLLASSHPTDLAIEGLRSLRTSLHFAMLEANNNRLMISGPSPKVGKS
                                                                      SGPSPKVGKS
                                                                             GKS
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVSANLAAVIAQSGQRVLLVDVDMRKGYIHKMFGIPVDNGLSDLLAKRCDLDTATHKTDIENLDVIGRGQVPPNPSELLM
FVSANLAAVIAQSGQRVLLVDVDMRKGYIHKMFGIPVDNGLSDLLAKRCDLDTATHKTDIENLDVIGRGQVPPNPSELLM
                 LLVDVDMR                                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKNFSEFLDQISARYDQVILDTPPFLAVTDAAIVGRQSGTNLIVTRFELNPAREVELTMRRFAQNGIELKGAIFNGVEKR
HKNFSEFLDQISARYDQVILDTPPFLAVTDAAIVGRQSGTNLIVTRFELNPAREVELTMRRFAQNGIELKGAIFNGVEKR
                 VILDTPP                                                        
       730       740  
....:....|....:....|..
ASAKYGYGAYGYYNYEYKSDSV
ASAKYGYGAYGYYNYEYKSDS 
    YGYGAYGYYNYEY     

© 1998-2019