BYKdb

Annotate results for A0A0M4D373

A0A0M4D373 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M4D373
DOMAINcd98/277TSTLPGEGKTVTAINLALTLAQEYDHTVLLVDADLRKPMVHKYLGIEPEVGLAHCLRDGV
PIEQALVKTGLGKLVVLPAGDAISDPVERFASQRMKEIITEIKSRYGDRYIIFDLPPVLP
FAEAQILGAEVDGVIFVIRQRQVKATEVQEALESLKPVNMLGVVFNCVTTPSKLGRYRYY
SITEWalker A105/107GKT
SITEWalker A'126/133LLVDADLR
SITEWalker B208/214IIFDLPP
SITE-203/-207YGDRY
SITEY Cluster274/277YRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRIEKALEKASLLRENQALEKASLRREYQERPPVPLEAGPRAPGHVALKVAPLPVNSPFLMSAGNCQAGIAEEYKKLKS


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVVKLTRAEAFRNTLAVTSTLPGEGKTVTAINLALTLAQEYDHTVLLVDADLRKPMVHKYLGIEPEVGLAHCLRDGVPIE
                 TSTLPGEGKTVTAINLALTLAQEYDHTVLLVDADLRKPMVHKYLGIEPEVGLAHCLRDGVPIE
                        GKT                  LLVDADLR                           
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QALVKTGLGKLVVLPAGDAISDPVERFASQRMKEIITEIKSRYGDRYIIFDLPPVLPFAEAQILGAEVDGVIFVIRQRQV
QALVKTGLGKLVVLPAGDAISDPVERFASQRMKEIITEIKSRYGDRYIIFDLPPVLPFAEAQILGAEVDGVIFVIRQRQV
                                               IIFDLPP                          
       250       260       270       
....:....|....:....|....:....|....:..
KATEVQEALESLKPVNMLGVVFNCVTTPSKLGRYRYY
KATEVQEALESLKPVNMLGVVFNCVTTPSKLGRYRYY
                                 YRYY
© 1998-2019