BYKdb

Annotate results for A0A0M4FWC9

A0A0M4FWC9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M4FWC9
DOMAINcd51/230TSASVGEGKSTVAANVAISFAQEGLKVLLIDADLRKPTLHYTFSILISPGFTNFLMSNWK
LEDVIRESEIKGLHLITSGPIPSNPSELLGSDLIYDLWKKIKSRYDIVIFDAPPILSVAD
AQILSEKCDATILVVDSGKTEKKNILKAKEVLEASKANTIGVILNNFILEKDHYYYEYYG
SITE-188/-190GKT
SITEWalker A'78/85LLIDADLR
SITEWalker B158/164VIFDAPP
SITEY Cluster224/229YYYEYY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKKKNNRNQNKRKLVISTNPKSIVAEQFRTVRANIKFAMKGKEFKTLLFTSASVGEGKSTVAANVAISFAQEGLKVLLI
                                                  TSASVGEGKSTVAANVAISFAQEGLKVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRKPTLHYTFSILISPGFTNFLMSNWKLEDVIRESEIKGLHLITSGPIPSNPSELLGSDLIYDLWKKIKSRYDIVIF
DADLRKPTLHYTFSILISPGFTNFLMSNWKLEDVIRESEIKGLHLITSGPIPSNPSELLGSDLIYDLWKKIKSRYDIVIF
DADLR                                                                        VIF
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAPPILSVADAQILSEKCDATILVVDSGKTEKKNILKAKEVLEASKANTIGVILNNFILEKDHYYYEYYG
DAPPILSVADAQILSEKCDATILVVDSGKTEKKNILKAKEVLEASKANTIGVILNNFILEKDHYYYEYYG
DAPP                                                           YYYEYY 
© 1998-2019