BYKdb

Annotate results for A0A0M4G5Y2

A0A0M4G5Y2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M4G5Y2
DOMAINcd54/236TSSTPGEGKSTSAANMAIVFAQEGKKVLLIDSDMRKPTMHHTFHITNTVGLSNLLTRKLT
MQDVVVDTNIECLDLITSGPIPPNPAELIGSKTMDILMNELMEKYDLIIFDAPPLLSVTD
AQILSNKCDGTILVINSGTTEKSNVIKAKEALIASKAKILGTLLNNFVLDKDHYYYQYYG
SVE
SITEWalker A61/63GKS
SITEWalker A'81/88LLIDSDMR
SITEWalker B161/167IIFDAPP
SITEY Cluster227/232YYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKKRSRNKKIQTAARKLITIENPKAVVSEQFRTVRTNINFSMPDKELKTLLITSSTPGEGKSTSAANMAIVFAQEGKKV
                                                     TSSTPGEGKSTSAANMAIVFAQEGKKV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDSDMRKPTMHHTFHITNTVGLSNLLTRKLTMQDVVVDTNIECLDLITSGPIPPNPAELIGSKTMDILMNELMEKYDL
LLIDSDMRKPTMHHTFHITNTVGLSNLLTRKLTMQDVVVDTNIECLDLITSGPIPPNPAELIGSKTMDILMNELMEKYDL
LLIDSDMR                                                                        
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
IIFDAPPLLSVTDAQILSNKCDGTILVINSGTTEKSNVIKAKEALIASKAKILGTLLNNFVLDKDHYYYQYYGSVE
IIFDAPPLLSVTDAQILSNKCDGTILVINSGTTEKSNVIKAKEALIASKAKILGTLLNNFVLDKDHYYYQYYGSVE
IIFDAPP                                                           YYYQYY    
© 1998-2019