BYKdb

Annotate results for A0A0M4GAZ4

A0A0M4GAZ4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M4GAZ4
DOMAINcd49/229TSSGPGEGKSTTTANLAVVFAQQGKSVLLIDADLRKPTVHYSFNLTNTIGLTNVLSHQVN
LEEAINETDVKGLYVVSSGPIPPNPSELLGSRMMDSFIKEAEGKFDIIMFDTPPVLAVTD
AQILSNKCDGTILVVSSENTEIEQAVKAKELLTTAQAKVLGVVLNNRKFEKNQQYYYYGV
K
SITE-72/-74GKS
SITEWalker A'76/83LLIDADLR
SITEWalker B156/162IMFDTPP
SITEY Cluster223/226YYYY
SITEWalker A56/58GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKKLLQGKRKLITKLDPKSPISEQYRTLRTNIQFSSVDEEIKKIMVTSSGPGEGKSTTTANLAVVFAQQGKSVLLIDA
                                                TSSGPGEGKSTTTANLAVVFAQQGKSVLLIDA
                                                       GKS                 LLIDA
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKPTVHYSFNLTNTIGLTNVLSHQVNLEEAINETDVKGLYVVSSGPIPPNPSELLGSRMMDSFIKEAEGKFDIIMFDT
DLRKPTVHYSFNLTNTIGLTNVLSHQVNLEEAINETDVKGLYVVSSGPIPPNPSELLGSRMMDSFIKEAEGKFDIIMFDT
DLR                                                                        IMFDT
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
PPVLAVTDAQILSNKCDGTILVVSSENTEIEQAVKAKELLTTAQAKVLGVVLNNRKFEKNQQYYYYGVK
PPVLAVTDAQILSNKCDGTILVVSSENTEIEQAVKAKELLTTAQAKVLGVVLNNRKFEKNQQYYYYGVK
PP                                                            YYYY   
© 1998-2019