BYKdb

Annotate results for A0A0M4TDZ4

A0A0M4TDZ4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M4TDZ4
DOMAINtad18/269DEIDLLALLLGLLRGWKTLLLFAFLGLVIGVLYSRYLNPVFKSDALIQIDNKFQGVSALG
SNISDLVSPDVSPAQTEAELIKSRMILKPVVDLLHLDIRLNDPTINKLDRIKNNRTDTQV
NSPESVILDTEDGPVQIRQFNVSQAYLNQSFTLVKSKTGFILSNGFDDFKGQLNQLNRFI
GSDGIIQITVTDLPNDNHPITITKQSLQNTTDAINGALIVKELGNKTGIIQLSLTGSNQQ
QVSLILNQIILS
DOMAINcd548/741SGESPGVGKSFISANLAEVFGQLNTKVLVIDADMRLGELHKIFNMDQDNGLADYLSQKND
ELQVDDNLADFIHSTSMDHIDFMPRGKHPHNPVSLLAGDSFRGLMTQLNAYYDYIVIDSP
PILAASDAIILSQYADKVLMVTRYEKSIEGQLVYAIKQLNKANVRVDGIILNDVKQGLMS
KYSYNYSYAYGSNK
SITEWalker A555/557GKS
SITEWalker A'575/582LVIDADMR
SITEWalker B662/668IVIDSPP
SITE-658/-661YYDY
SITEY Cluster729/737YSYNYSYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNTESNKFSKPIAENDNDEIDLLALLLGLLRGWKTLLLFAFLGLVIGVLYSRYLNPVFKSDALIQIDNKFQGVSALGSNI
                 DEIDLLALLLGLLRGWKTLLLFAFLGLVIGVLYSRYLNPVFKSDALIQIDNKFQGVSALGSNI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDLVSPDVSPAQTEAELIKSRMILKPVVDLLHLDIRLNDPTINKLDRIKNNRTDTQVNSPESVILDTEDGPVQIRQFNVS
SDLVSPDVSPAQTEAELIKSRMILKPVVDLLHLDIRLNDPTINKLDRIKNNRTDTQVNSPESVILDTEDGPVQIRQFNVS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAYLNQSFTLVKSKTGFILSNGFDDFKGQLNQLNRFIGSDGIIQITVTDLPNDNHPITITKQSLQNTTDAINGALIVKEL
QAYLNQSFTLVKSKTGFILSNGFDDFKGQLNQLNRFIGSDGIIQITVTDLPNDNHPITITKQSLQNTTDAINGALIVKEL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNKTGIIQLSLTGSNQQQVSLILNQIILSYVGQNQSRGSEETTKTLTFMETQIPALKQKLEASEKVFNEFREKYGTIDIG
GNKTGIIQLSLTGSNQQQVSLILNQIILS                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEAGLLLSENSKIDSQINDLKLKKADLITYYTEDHPLVIQINEQLKVLNNKKQEIDDRVTRLPNIQREFLKLSEDTGINR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIYLTMLKNYEQLKIVKAGQIGYARIIDSPISTYRAIAPNKKLIILLATILGTFLGATLVLLKNLLKSTVKDSERLETKT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVPVIATIPSSPLLSRLSKNKKAPNRLLAYVDSNSLSYEAIKSLRTHLMFGMPKEGKAGQRAKVILISGESPGVGKSFIS
                                                                   SGESPGVGKSFIS
                                                                          GKS   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANLAEVFGQLNTKVLVIDADMRLGELHKIFNMDQDNGLADYLSQKNDELQVDDNLADFIHSTSMDHIDFMPRGKHPHNPV
ANLAEVFGQLNTKVLVIDADMRLGELHKIFNMDQDNGLADYLSQKNDELQVDDNLADFIHSTSMDHIDFMPRGKHPHNPV
              LVIDADMR                                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLLAGDSFRGLMTQLNAYYDYIVIDSPPILAASDAIILSQYADKVLMVTRYEKSIEGQLVYAIKQLNKANVRVDGIILND
SLLAGDSFRGLMTQLNAYYDYIVIDSPPILAASDAIILSQYADKVLMVTRYEKSIEGQLVYAIKQLNKANVRVDGIILND
                     IVIDSPP                                                    
       730       740 
....:....|....:....|.
VKQGLMSKYSYNYSYAYGSNK
VKQGLMSKYSYNYSYAYGSNK
        YSYNYSYAY    

© 1998-2019