BYKdb

Annotate results for A0A0M6W8C0

A0A0M6W8C0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M6W8C0
DOMAINcd62/249TSSAMSEGKSTVSANVAVTWAQAGKKVLLIDADLRRPTIQATFRKLNLDGVTTVLTGKMK
PDEVVSDTFVEGLSVVTSGPVPPNPSELLNSKKMIQLLDWARDNFDIIVLDAPPVLAVSD
VQVLVPKTDGVVVVANMGKTLKGDLQRTVEVLKLAKAKILGSVERVKTKRGDRGYGYGYG
YGYGNEKN
SITE-199/-201GKT
SITEWalker A'89/96LLIDADLR
SITEWalker B169/175IVLDAPP
SITEY Cluster236/244YGYGYGYGY
SITEWalker A69/71GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNWSLKSILPNRKIDQETQKNGVLLVTFAEPKHVVSEQFRTVRTNIEFAGAALNKCQVIMFTSSAMSEGKSTVSANVAVT
                                                             TSSAMSEGKSTVSANVAVT
                                                                    GKS         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WAQAGKKVLLIDADLRRPTIQATFRKLNLDGVTTVLTGKMKPDEVVSDTFVEGLSVVTSGPVPPNPSELLNSKKMIQLLD
WAQAGKKVLLIDADLRRPTIQATFRKLNLDGVTTVLTGKMKPDEVVSDTFVEGLSVVTSGPVPPNPSELLNSKKMIQLLD
        LLIDADLR                                                                
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WARDNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLQRTVEVLKLAKAKILGSVERVKTKRGDRGYGYGY
WARDNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLQRTVEVLKLAKAKILGSVERVKTKRGDRGYGYGY
        IVLDAPP                                                            YGYGY
         
....:....
GYGYGNEKN
GYGYGNEKN
GYGY     
© 1998-2019