BYKdb

Annotate results for A0A0M6WRN5

A0A0M6WRN5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M6WRN5
DOMAINcd40/235TSSLPNEGKTTVVMDLARSMADSKKSVLVVDTDMRKSVLVGRIRAKLESGGKIYGLSHYL
SGQVSLDKVIYATNIKGVFILFAGHEVPNPTELLETEEFKELIEFGEKNFDYVLVDTPPT
GAAIDAAVVGKNVDGAVIVAAQNATSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYG
HYYGNYYGNYYGNYYG
SITEWalker A47/49GKT
SITEWalker A'67/74LVVDTDMR
SITEWalker B152/158VLVDTPP
SITE-93/-98YGLSHY
SITEY Cluster218/234YGHYYGNYYGNYYGNYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSLPNEGKTTVVMDLARSMADSKKSVLVVDTDMRKSVLVG
                                       TSSLPNEGKTTVVMDLARSMADSKKSVLVVDTDMRKSVLVG
                                              GKT                 LVVDTDMR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIRAKLESGGKIYGLSHYLSGQVSLDKVIYATNIKGVFILFAGHEVPNPTELLETEEFKELIEFGEKNFDYVLVDTPPTG
RIRAKLESGGKIYGLSHYLSGQVSLDKVIYATNIKGVFILFAGHEVPNPTELLETEEFKELIEFGEKNFDYVLVDTPPTG
                                                                       VLVDTPP  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAIDAAVVGKNVDGAVIVAAQNATSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYGRDDDE
AAIDAAVVGKNVDGAVIVAAQNATSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYG     
                                                         YGHYYGNYYGNYYGNYY      
 
.
N


© 1998-2019