BYKdb

Annotate results for A0A0M6WXE3

A0A0M6WXE3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M6WXE3
DOMAINtad14/144TEFEPISLVCDILKNWWVILLGALAGAMLFYVASSMIYVPNYRTQATFVITSRENANAYN
NLSSANSMAETFQKILESTIMKKTICEKLDMDKLDADISANVVKGTNMLTLSVTAHSPKD
SIDIIKTVMDN
DOMAINcd280/470TSVCENEGKSSVAGNLAITLAKKGKRIILIDGDIRCPAQYLLLGMSPKKENELGEFLNGR
TGANNILLNTERKRLGFIGGKVSYSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGMI
GDAQIFAQHADAVMVVARQNVTLAEDINEMMDDFRDNHTKVLGVVLNGVMTFQSIADSPV
GDHYSRYSRYG
SITEWalker A287/289GKS
SITEWalker A'307/314ILIDGDIR
SITEWalker B389/395VIIDTPP
SITEY Cluster463/478YSRYSRYGRYGRYGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MENNRENASAQTETEFEPISLVCDILKNWWVILLGALAGAMLFYVASSMIYVPNYRTQATFVITSRENANAYNNLSSANS
             TEFEPISLVCDILKNWWVILLGALAGAMLFYVASSMIYVPNYRTQATFVITSRENANAYNNLSSANS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAETFQKILESTIMKKTICEKLDMDKLDADISANVVKGTNMLTLSVTAHSPKDSIDIIKTVMDNYTSISYYTVGTTVLDV
MAETFQKILESTIMKKTICEKLDMDKLDADISANVVKGTNMLTLSVTAHSPKDSIDIIKTVMDN                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEDPKIPYAPVNPPQNGEMAKKGFFLGMAVCILLFAIWSYMHNTVKQEREVEKKLDARSLGAISYEWKYKTIKEWIKHRK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KAVLVDNPLASFRFVESFKMLAARVEYHMSKINGKVLVVTSVCENEGKSSVAGNLAITLAKKGKRIILIDGDIRCPAQYL
                                       TSVCENEGKSSVAGNLAITLAKKGKRIILIDGDIRCPAQYL
                                              GKS                 ILIDGDIR      
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLGMSPKKENELGEFLNGRTGANNILLNTERKRLGFIGGKVSYSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGMIG
LLGMSPKKENELGEFLNGRTGANNILLNTERKRLGFIGGKVSYSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGMIG
                                                                    VIIDTPP     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAQIFAQHADAVMVVARQNVTLAEDINEMMDDFRDNHTKVLGVVLNGVMTFQSIADSPVGDHYSRYSRYGRYGRYGKYTN
DAQIFAQHADAVMVVARQNVTLAEDINEMMDDFRDNHTKVLGVVLNGVMTFQSIADSPVGDHYSRYSRYG          
                                                              YSRYSRYGRYGRYGKY  
    
....
NKEV


© 1998-2019