BYKdb

Annotate results for A0A0M6WYQ8

A0A0M6WYQ8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M6WYQ8
DOMAINtad17/151EKIDLIEFLRSFQYGIKKMWWLVLVLALIFGLNSYIKARKNYTPVYTASATVAVTTIDGS
PAYQNNASAQQMADVFPYILTSGVLKDVVAKDMKLDSVPGSISVKAEEGTNMLTISVSGT
NAELSYKTLKSVIKN
DOMAINcd284/478TSSVPEEGKTAFSVNLAIIEAKLGKNVILVDCDMRRPSVAKAMNQEGEFPGLQAVLQGKV
KISEAMTTVELEKCPGSLQILYGKTTEGSSSDLLESKQMERLISILKKKADLVIFDTAPS
EMLADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENISMSGIHMLGYVLNRDRSTGGGYG
YGYGYYGRYRYGRYG
SITEWalker A291/293GKT
SITEWalker A'311/318ILVDCDMR
SITEWalker B396/402VIFDTAP
SITE-415/-427YLDAAVYVIRYDY
SITE-366/-368GKT
SITE-415/-474YLDAAVYVIRYDYAKMRQIRMGVENISMSGIHMLGYVLNRDRSTGGGYGYGYGYYGRYRY
SITE-472/-486YRYGRYGRYGRYGGY
SITEY Cluster462/486YGYGYGYYGRYRYGRYGRYGRYGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDEMREKSGKEQQGEIEKIDLIEFLRSFQYGIKKMWWLVLVLALIFGLNSYIKARKNYTPVYTASATVAVTTIDGSPAYQ
                EKIDLIEFLRSFQYGIKKMWWLVLVLALIFGLNSYIKARKNYTPVYTASATVAVTTIDGSPAYQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNASAQQMADVFPYILTSGVLKDVVAKDMKLDSVPGSISVKAEEGTNMLTISVSGTNAELSYKTLKSVIKNYPEVAQFVL
NNASAQQMADVFPYILTSGVLKDVVAKDMKLDSVPGSISVKAEEGTNMLTISVSGTNAELSYKTLKSVIKN         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNTTLKILDETGVPDDTTNQGVISSSWKRGALKGAIIGLVILSLYVLTRRTVKTGKEIKTHLNLVDLGTLPEVHVKKRNK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESFYNSVNVLNKRIPQGYLEAFRKVGIKVMKQMEEEEFKTLLVTSSVPEEGKTAFSVNLAIIEAKLGKNVILVDCDMRRP
                                           TSSVPEEGKTAFSVNLAIIEAKLGKNVILVDCDMRRP
                                                  GKT                 ILVDCDMR  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVAKAMNQEGEFPGLQAVLQGKVKISEAMTTVELEKCPGSLQILYGKTTEGSSSDLLESKQMERLISILKKKADLVIFDT
SVAKAMNQEGEFPGLQAVLQGKVKISEAMTTVELEKCPGSLQILYGKTTEGSSSDLLESKQMERLISILKKKADLVIFDT
                                                                           VIFDT
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APSEMLADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENISMSGIHMLGYVLNRDRSTGGGYGYGYGYYGRYRYGRYGRY
APSEMLADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENISMSGIHMLGYVLNRDRSTGGGYGYGYGYYGRYRYGRYG  
AP                                                           YGYGYGYYGRYRYGRYGRY
       490       500       510        
....:....|....:....|....:....|....:...
GRYGGYRHYSRYEKQFDEPEEETGAVNQKEVFTETKEN

GRYGGY                                
© 1998-2019