BYKdb

Annotate results for A0A0M6WZD6

A0A0M6WZD6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M6WZD6
DOMAINcd40/240TSAMPNEGKSTVTMDLARSFSESGKRVLLIDTDMRKSVYVGRLRAVASDGREIYGLSHFL
SGQRKLEDVLYGTTIPGLFMIFAGPSVPNPTEILEKKYFTELLNFAKEHFDYVLLDCAPI
GAAIDAAVIAKHCDGAILVIAQGMASGRLIQTVKKQMEASGVRVLGAVLNKVRMKKNGYE
GGYYGGYYGSYYGNYGEHHEK
SITEWalker A47/49GKS
SITEWalker A'67/74LLIDTDMR
SITEWalker B152/158VLLDCAP
SITEY Cluster218/234YEGGYYGGYYGSYYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKSVTFENLKKQNYTMKESLRALKTNIQFCGDDICTIVVTSAMPNEGKSTVTMDLARSFSESGKRVLLIDTDMRKSVYVG
                                       TSAMPNEGKSTVTMDLARSFSESGKRVLLIDTDMRKSVYVG
                                              GKS                 LLIDTDMR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLRAVASDGREIYGLSHFLSGQRKLEDVLYGTTIPGLFMIFAGPSVPNPTEILEKKYFTELLNFAKEHFDYVLLDCAPIG
RLRAVASDGREIYGLSHFLSGQRKLEDVLYGTTIPGLFMIFAGPSVPNPTEILEKKYFTELLNFAKEHFDYVLLDCAPIG
                                                                       VLLDCAP  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAIDAAVIAKHCDGAILVIAQGMASGRLIQTVKKQMEASGVRVLGAVLNKVRMKKNGYEGGYYGGYYGSYYGNYGEHHEK
AAIDAAVIAKHCDGAILVIAQGMASGRLIQTVKKQMEASGVRVLGAVLNKVRMKKNGYEGGYYGGYYGSYYGNYGEHHEK
                                                         YEGGYYGGYYGSYYGNY      
  
..
NA


© 1998-2019