BYKdb

Annotate results for A0A0M6XRQ5

A0A0M6XRQ5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M6XRQ5
DOMAINtad18/224VVLDFGRILAIIRRSWWLIGGLGLAGAIVAAIAVLQVTPTYQSGAELLLGQKARLDDAMG
ALFQDLRLDDAAISGEVAIITSGRLLSEATERLDLQSHPEFNPDLRPPEDEPGLLSRIAD
GAVNLLKRAMGLGTGDEPDGLTGPGGSPVRDAAMTGKTALGEQADYVDQLRQGLSVRQVG
RSNLVSIHYLSTDRMLAAAVPNALIDI
DOMAINcd566/740VSTRPGAGKTTTAVNLGRLFAKMGKSCVLVDADQRRGNIAALLKLPLDPDLIDVIEGEAT
LDEALHEDSQTGMHILTTRLDAPDPAGILLSRKMTDLIGTLKQRFDVVIVDTAPLLPVAD
ALPVVRLADQVVMMVPYGSKADDVATGRRMLDRAGRPPSCAVMSFAPANTISSYY
SITE-589/-591GKS
SITEWalker A'593/600VLVDADQR
SITEWalker B673/679VIVDTAP
SITEY Cluster739/740YY
SITEWalker A573/575GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIQPAGGETGPETRSQDVVLDFGRILAIIRRSWWLIGGLGLAGAIVAAIAVLQVTPTYQSGAELLLGQKARLDDAMGALF
                 VVLDFGRILAIIRRSWWLIGGLGLAGAIVAAIAVLQVTPTYQSGAELLLGQKARLDDAMGALF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDLRLDDAAISGEVAIITSGRLLSEATERLDLQSHPEFNPDLRPPEDEPGLLSRIADGAVNLLKRAMGLGTGDEPDGLTG
QDLRLDDAAISGEVAIITSGRLLSEATERLDLQSHPEFNPDLRPPEDEPGLLSRIADGAVNLLKRAMGLGTGDEPDGLTG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGGSPVRDAAMTGKTALGEQADYVDQLRQGLSVRQVGRSNLVSIHYLSTDRMLAAAVPNALIDIYLEDQIDRRFAVLSRA
PGGSPVRDAAMTGKTALGEQADYVDQLRQGLSVRQVGRSNLVSIHYLSTDRMLAAAVPNALIDI                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSGLESRLNTMRDRVESSERATIDYRTRNLSDGFGSRVQLDQQLSDLSVRLSAASAEYAELASELRGLNTLIDDQGAIAT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGLFASPTIDTLRVELSDLRRREDRLREQFGSDIPQLADTVREIERLEAALSEEVLTLRDDKAKLVDIAGARRQALANEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SELEQRAIALADREVRLAQLEREQSAAQLVYETFLDRFNQTRDVGDLQESDAQVIDYASPPPAPVAPNKKLAVALGGFAG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFLGLALAFGHAVVDTRLRTLDGVQRLMRGADTILMPRVSSFWRRGDPLHTALRNPQSAVAESLRTLRSSLMMAAPASGG


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVVTFVSTRPGAGKTTTAVNLGRLFAKMGKSCVLVDADQRRGNIAALLKLPLDPDLIDVIEGEATLDEALHEDSQTGMHI
     VSTRPGAGKTTTAVNLGRLFAKMGKSCVLVDADQRRGNIAALLKLPLDPDLIDVIEGEATLDEALHEDSQTGMHI
            GKT                 VLVDADQR                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTTRLDAPDPAGILLSRKMTDLIGTLKQRFDVVIVDTAPLLPVADALPVVRLADQVVMMVPYGSKADDVATGRRMLDRAG
LTTRLDAPDPAGILLSRKMTDLIGTLKQRFDVVIVDTAPLLPVADALPVVRLADQVVMMVPYGSKADDVATGRRMLDRAG
                                VIVDTAP                                         
       730       740
....:....|....:....|
RPPSCAVMSFAPANTISSYY
RPPSCAVMSFAPANTISSYY
                  YY

© 1998-2019