BYKdb

Annotate results for A0A0M6YG59

A0A0M6YG59 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M6YG59
DOMAINcd99/287TSPGPGCGKSTVTMNLAFSLARQPDIRTLVIDLDLRRPMLANLLGLTDRHEITAVIRGKA
DAATQIARVTDNLAFATTRTPVHDPAELLQGRRIGDMLRSLEERFAPDVILFDLPPIMVS
DDAIAFLPNTDCALMIAAAEQSTLGQVDICEKELAAQTSVLGVVLNKCPYPGDGQRYGYG
YGYGADADG
SITEWalker A106/108GKS
SITEWalker A'127/134LVIDLDLR
SITEWalker B208/214ILFDLPP
SITEY Cluster275/281YGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDRIQAAIARARTERDALLAGHRPEPSAVAPQPDAIVTPTPGAADAWSALPIFKPDAAHLEKNRIVTRDSGAKSAPFDVL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTRALQQMSAEGWTRLAVTSPGPGCGKSTVTMNLAFSLARQPDIRTLVIDLDLRRPMLANLLGLTDRHEITAVIRGKADA
                  TSPGPGCGKSTVTMNLAFSLARQPDIRTLVIDLDLRRPMLANLLGLTDRHEITAVIRGKADA
                         GKS                  LVIDLDLR                          
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATQIARVTDNLAFATTRTPVHDPAELLQGRRIGDMLRSLEERFAPDVILFDLPPIMVSDDAIAFLPNTDCALMIAAAEQS
ATQIARVTDNLAFATTRTPVHDPAELLQGRRIGDMLRSLEERFAPDVILFDLPPIMVSDDAIAFLPNTDCALMIAAAEQS
                                               ILFDLPP                          
       250       260       270       280       
....:....|....:....|....:....|....:....|....:..
TLGQVDICEKELAAQTSVLGVVLNKCPYPGDGQRYGYGYGYGADADG
TLGQVDICEKELAAQTSVLGVVLNKCPYPGDGQRYGYGYGYGADADG
                                  YGYGYGY      
© 1998-2019