BYKdb

Annotate results for A0A0M8JPC7

A0A0M8JPC7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M8JPC7
DOMAINcd329/517TSPDTGDGKTSVAANLAVSFSQGGKRVILVDGDLRKPSLHEFFDISDRRGLTDVLQGKLS
VEKALRTWDGGGLRLITVGDEAVLPDLLLTAEKVENLLCELKPLADIILIDSSPFLVSDA
MIFAAKVDGVITVIRPGYTSREMARVMKERIAMAGGKIIGVVLNRIPLKRIGYYGGYRYY
LPYGYYEKK
SITEWalker A336/338GKT
SITEWalker A'356/363ILVDGDLR
SITEWalker B436/442ILIDSSP
SITEY Cluster501/514YYGGYRYYLPYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDIRPYLAPIFKWWWLLLAAAALATGTAYFILRDQPAVYTARTTLMIGRTLLEANPSSNDFWLNQQLSSLYSDMAYREPV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEGVKKALGMTWLPKYVVKTFGNGQFIEIDVIDTSPERAMHVASELANQLILVSPGSKEVNSNNEAFIQEQLQKLQEQIV


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATEKELVARQDSLGGLTSAHEIEQAKAELRTLEDKLSLLRTNYANLLSSSKENITNILQVIEPASLPVRPTGPNRYLIIA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LCGMAGLVLGAGCAYLLEYLDEAIQNPEELARLIDAPIVGYISDLGRKANASLYVARHPRSLMAEAFRTLRANIELQNLD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NGPLALLITSPDTGDGKTSVAANLAVSFSQGGKRVILVDGDLRKPSLHEFFDISDRRGLTDVLQGKLSVEKALRTWDGGG
        TSPDTGDGKTSVAANLAVSFSQGGKRVILVDGDLRKPSLHEFFDISDRRGLTDVLQGKLSVEKALRTWDGGG
               GKT                 ILVDGDLR                                     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRLITVGDEAVLPDLLLTAEKVENLLCELKPLADIILIDSSPFLVSDAMIFAAKVDGVITVIRPGYTSREMARVMKERIA
LRLITVGDEAVLPDLLLTAEKVENLLCELKPLADIILIDSSPFLVSDAMIFAAKVDGVITVIRPGYTSREMARVMKERIA
                                   ILIDSSP                                      
       490       500       510       520       530         
....:....|....:....|....:....|....:....|....:....|....:....
MAGGKIIGVVLNRIPLKRIGYYGGYRYYLPYGYYEKKKKREEDEDKKVPKKSELTFSGK
MAGGKIIGVVLNRIPLKRIGYYGGYRYYLPYGYYEKK                      
                    YYGGYRYYLPYGYY                         
© 1998-2019