BYKdb

Annotate results for A0A0M8KAF3

A0A0M8KAF3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M8KAF3
DOMAINtad15/148DTIDLRQYWLLIRRWWWAFVLALLLGAVAAYIASQFQQPIYRAEARILVSQSSSSDLNDI
YRDIVIGERLVKTYAEIMKSDAVLDLVAETVGEEALEEAKISVSPGQDTQLLVVAVEHPD
PELAATIANEVVRV
DOMAINcd348/539TSSEPGEGKTTTAANLALVMAQAGRKVVLVDADLRKPLVHRLFQLSNAQGLTSALMHPEI
AVDRFLQRVDAGGGQTLWVLPSGPLPPNPAEVVGSRRMQELLDELMTFADIVILDTPPVL
VVADPALLARMSDGVLLVTRMNVTHRQALQRAIEQLRYAEARILGVVVNDLTARDGGYYY
YAYSQYYHHDDG
SITEWalker A355/357GKT
SITEWalker A'375/382VLVDADLR
SITEWalker B459/465VILDTPP
SITEY Cluster525/534YYYYAYSQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNTPLVPPDMLTDEDTIDLRQYWLLIRRWWWAFVLALLLGAVAAYIASQFQQPIYRAEARILVSQSSSSDLNDIYRDIVI
              DTIDLRQYWLLIRRWWWAFVLALLLGAVAAYIASQFQQPIYRAEARILVSQSSSSDLNDIYRDIVI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GERLVKTYAEIMKSDAVLDLVAETVGEEALEEAKISVSPGQDTQLLVVAVEHPDPELAATIANEVVRVFSAYMRRVQTER
GERLVKTYAEIMKSDAVLDLVAETVGEEALEEAKISVSPGQDTQLLVVAVEHPDPELAATIANEVVRV            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FAESKANLQAQMERVQAEIEQLQQQLDALGTPETEAEQTRQQQLQTLLTQQQAAYTTLLRSYEEVRLAEAQAVDSIVVID


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PATPPERPVRPRVLLNTLLGGVLALVAVGAVVVLIEVLDDRVRSPEVIERLTGLPMIGAIAHIEGTNGDGVLVAREQPRA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVSEAYRVVRTNLQFAEVQSPLHSLVVTSSEPGEGKTTTAANLALVMAQAGRKVVLVDADLRKPLVHRLFQLSNAQGLTS
                           TSSEPGEGKTTTAANLALVMAQAGRKVVLVDADLRKPLVHRLFQLSNAQGLTS
                                  GKT                 VLVDADLR                  
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALMHPEIAVDRFLQRVDAGGGQTLWVLPSGPLPPNPAEVVGSRRMQELLDELMTFADIVILDTPPVLVVADPALLARMSD
ALMHPEIAVDRFLQRVDAGGGQTLWVLPSGPLPPNPAEVVGSRRMQELLDELMTFADIVILDTPPVLVVADPALLARMSD
                                                          VILDTPP               
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVLLVTRMNVTHRQALQRAIEQLRYAEARILGVVVNDLTARDGGYYYYAYSQYYHHDDGSGGDGTRPERKRRRADASRKG
GVLLVTRMNVTHRQALQRAIEQLRYAEARILGVVVNDLTARDGGYYYYAYSQYYHHDDG                     
                                            YYYYAYSQYY                          
       570   
....:....|...
VMARLLSFVNVKS


© 1998-2019