BYKdb

Annotate results for A0A0M8KP53

A0A0M8KP53 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M8KP53
DOMAINtad1/135MELQQYLTILKERWSTVAIAAVIVLAVVSTLTLTRTPTYTATNRVFVQTEAGGSVSERSS
GVNFASQQIITYADLAKTPIVLDPVIEELGLDLTAEQLADRISTRIPEDTLIIDITASSV
DPQVASAIANATSES
DOMAINcd280/468TSSLSGEGKSSTAINLAQVLAQAGDRVLLVDADLRRPSLATELGLERTVGLTTVLIGDVE
LDDVTQPLETAGLDVLTSGPIPPNPSELLGSEAMRSLLEAASEAYDYVVVDTAPLLAVTD
AVALSRFVDGSLVVAQCDRVKKQQFGEALAKMDSVDARVLGVVVNNAPRDVRDVYTYLPD
EESSEPAVS
SITEWalker A287/289GKS
SITEWalker A'307/314LLVDADLR
SITEWalker B387/393VVVDTAP
SITE-384/-386YDY
SITEY Cluster454/456YTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELQQYLTILKERWSTVAIAAVIVLAVVSTLTLTRTPTYTATNRVFVQTEAGGSVSERSSGVNFASQQIITYADLAKTPI
MELQQYLTILKERWSTVAIAAVIVLAVVSTLTLTRTPTYTATNRVFVQTEAGGSVSERSSGVNFASQQIITYADLAKTPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDPVIEELGLDLTAEQLADRISTRIPEDTLIIDITASSVDPQVASAIANATSESLRTQVSTLEAPTQEAAATGTTEDGL
VLDPVIEELGLDLTAEQLADRISTRIPEDTLIIDITASSVDPQVASAIANATSES                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAVPSTVELTVISSAATPSSPASPNIPRDLALGVLLALLAGLAAAVVRDFLDNRVRRPADIEALYDLPVIGSIPSVHSSQ


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVALIAAQKPSSVQAEAYRELRTNLHFMLIADRMKTLLVTSSLSGEGKSSTAINLAQVLAQAGDRVLLVDADLRRPSLAT
                                       TSSLSGEGKSSTAINLAQVLAQAGDRVLLVDADLRRPSLAT
                                              GKS                 LLVDADLR      
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELGLERTVGLTTVLIGDVELDDVTQPLETAGLDVLTSGPIPPNPSELLGSEAMRSLLEAASEAYDYVVVDTAPLLAVTDA
ELGLERTVGLTTVLIGDVELDDVTQPLETAGLDVLTSGPIPPNPSELLGSEAMRSLLEAASEAYDYVVVDTAPLLAVTDA
                                                                  VVVDTAP       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VALSRFVDGSLVVAQCDRVKKQQFGEALAKMDSVDARVLGVVVNNAPRDVRDVYTYLPDEESSEPAVSVVPAEDRPAEAW
VALSRFVDGSLVVAQCDRVKKQQFGEALAKMDSVDARVLGVVVNNAPRDVRDVYTYLPDEESSEPAVS            
                                                     YTY                        
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PEDARPSGSASSEHRHEEALEAEEATGDRPEALPAARAARPTAMHGGRPAAPRRRAVRRPEATRPDDSRQSGSDRSSGGT


       570       580      
....:....|....:....|....:.
HEADVPAGGPALTVSGGAGRQGARSA


© 1998-2019