BYKdb

Annotate results for A0A0M9E0E3

A0A0M9E0E3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M9E0E3
DOMAINcd85/277TSAGPSEGKTLTSTNLAITMAQAGSRVIIVDCDMRKPKVHKMFNLSRDMGMSSVLVSEDL
ETILNDVTLPSGIPNLEVIPCGPIPPNPSEIIGSQKMSLIMDELGKRYDRIIVDSPPITA
VTDSTVLAKFVDGVMLVVHAGVTPKQVVKTGLEQIQGVEANVLGAVLNDVDTGKESYYYY
QYYYYYYGEDGDK
SITEWalker A92/94GKT
SITEWalker A'112/119IIVDCDMR
SITEWalker B195/201IIVDSPP
SITEY Cluster261/271YYYYQYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGTALAFTFEILDNTLKNPEDIREYLKIPYLGPVPTFDLEKEGVDKPELITHYSPKSTASESYRGIRTSLLFSSADKVPK


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IILVTSAGPSEGKTLTSTNLAITMAQAGSRVIIVDCDMRKPKVHKMFNLSRDMGMSSVLVSEDLETILNDVTLPSGIPNL
    TSAGPSEGKTLTSTNLAITMAQAGSRVIIVDCDMRKPKVHKMFNLSRDMGMSSVLVSEDLETILNDVTLPSGIPNL
           GKT                 IIVDCDMR                                         
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVIPCGPIPPNPSEIIGSQKMSLIMDELGKRYDRIIVDSPPITAVTDSTVLAKFVDGVMLVVHAGVTPKQVVKTGLEQIQ
EVIPCGPIPPNPSEIIGSQKMSLIMDELGKRYDRIIVDSPPITAVTDSTVLAKFVDGVMLVVHAGVTPKQVVKTGLEQIQ
                                  IIVDSPP                                       
       250       260       270       280       290  
....:....|....:....|....:....|....:....|....:....|..
GVEANVLGAVLNDVDTGKESYYYYQYYYYYYGEDGDKKKKNQRKKRSSKRYG
GVEANVLGAVLNDVDTGKESYYYYQYYYYYYGEDGDK               
                    YYYYQYYYYYY                     
© 1998-2019