BYKdb

Annotate results for A0A0M9FC23

A0A0M9FC23 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M9FC23
DOMAINtad17/256DEIDLGKLFGILVDSRWSIIVTTLLFTFIGIAYALLATPVYKADALIQVEQKSTGMPALG
GDMAELFSSESTATTEIEIIKSRMVLGETVDKLNLSVVATPNYIPVIGKGLARLSGESAS
IAISRFILPEHMQTNGYVLTVTNSEKGKYTLANSEGREILQGRVGELVEQNGISLFVTDI
HAKDEATFTLSKISRLDAIQNLQRDLSISERGKQTGILQLSMTGKNRSEIKDILNDISQN
DOMAINcd536/724SGPSPGIGKSFVSANLSSVIAKAGQRVLVIDADMRKGRMETQLCTDSKPGLSDYLCGKQE
FGNVVRETGVGGLDFIPRGDTPPNPSELLMHPRFKALIDWAQQNYDMVIVDTPPILAVTD
AAIVGAHVGTTLLVGRFEQNTVKEIDVAKNRFEQNGIEVKGFILNAIVRKASSTYGGNYG
YYNYSYDNK
SITEWalker A543/545GKS
SITEWalker A'563/570LVIDADMR
SITEWalker B643/649VIVDTPP
SITEY Cluster710/721YGGNYGYYNYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLTQNLANKATPNTSDEIDLGKLFGILVDSRWSIIVTTLLFTFIGIAYALLATPVYKADALIQVEQKSTGMPALGGDMA
                DEIDLGKLFGILVDSRWSIIVTTLLFTFIGIAYALLATPVYKADALIQVEQKSTGMPALGGDMA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELFSSESTATTEIEIIKSRMVLGETVDKLNLSVVATPNYIPVIGKGLARLSGESASIAISRFILPEHMQTNGYVLTVTNS
ELFSSESTATTEIEIIKSRMVLGETVDKLNLSVVATPNYIPVIGKGLARLSGESASIAISRFILPEHMQTNGYVLTVTNS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKGKYTLANSEGREILQGRVGELVEQNGISLFVTDIHAKDEATFTLSKISRLDAIQNLQRDLSISERGKQTGILQLSMTG
EKGKYTLANSEGREILQGRVGELVEQNGISLFVTDIHAKDEATFTLSKISRLDAIQNLQRDLSISERGKQTGILQLSMTG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNRSEIKDILNDISQNYFLQNVERNSAEAEKSLVFLKKHLPEIKAQLNNAEERLNQYRQLNESVDLNLEAKSALEVMVNV
KNRSEIKDILNDISQN                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAQLNELTFKESDISQRFTKEHPAYIALLDKRKTLLAEKARLNKRVEKLPKTQQEILRLTRSVEVNQQIYVELLNKVQEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIVKASTVGNVRILDSAQTYSQAVKPKKALIVVLATLLGGMLSVAIALLRAAFHKGVETPDQIEELGLPVYASIPLSDSQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELLKMQKGKKDNLTVEQTLLSVYNPADLSIEALRSLRTSLHFAMMEAKNNVLMISGPSPGIGKSFVSANLSSVIAKAGQ
                                                       SGPSPGIGKSFVSANLSSVIAKAGQ
                                                              GKS               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVLVIDADMRKGRMETQLCTDSKPGLSDYLCGKQEFGNVVRETGVGGLDFIPRGDTPPNPSELLMHPRFKALIDWAQQNY
RVLVIDADMRKGRMETQLCTDSKPGLSDYLCGKQEFGNVVRETGVGGLDFIPRGDTPPNPSELLMHPRFKALIDWAQQNY
  LVIDADMR                                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMVIVDTPPILAVTDAAIVGAHVGTTLLVGRFEQNTVKEIDVAKNRFEQNGIEVKGFILNAIVRKASSTYGGNYGYYNYS
DMVIVDTPPILAVTDAAIVGAHVGTTLLVGRFEQNTVKEIDVAKNRFEQNGIEVKGFILNAIVRKASSTYGGNYGYYNYS
  VIVDTPP                                                            YGGNYGYYNYS
    
....
YDNK
YDNK
Y   

© 1998-2019