BYKdb

Annotate results for A0A0M9TXK0

A0A0M9TXK0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0M9TXK0
DOMAINtad15/177ALIDLRRVGGVLRRRWMVLCAAMAAAIVIAAAAYIAAEPRYLATAQVALERTAERVINVD
SVVPTSDPDSAAVDTEVQALRSPELIGRVVDRLRLARDPAFNNAAGEGQPTAQPDLIGRQ
RAIGTLLGGLTVKRDGLSYAISVSYEGSTPVQAAQIANALVDD
DOMAINcd527/714TSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADARRRASSRQFTDGVTLGLDEVLAGQAT
LDQAIVKDSLSGAFLLPQRIDSKGVGLTESPRLAELIEQVRERYDLVILDTPPVLPVDEA
RVIASMADGVVLLVRWRKTPSKAVSVALRRLYDVHAEMLGAVLTLVDVREQERAGYEDGG
TFMKAYRS
SITEWalker A534/536GKT
SITEWalker A'554/561LLIDADAR
SITEWalker B633/639VILDTPP
SITEY Cluster712/716YRSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRSRQADPQVDRGALIDLRRVGGVLRRRWMVLCAAMAAAIVIAAAAYIAAEPRYLATAQVALERTAERVINVDSVVPTS
              ALIDLRRVGGVLRRRWMVLCAAMAAAIVIAAAAYIAAEPRYLATAQVALERTAERVINVDSVVPTS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DPDSAAVDTEVQALRSPELIGRVVDRLRLARDPAFNNAAGEGQPTAQPDLIGRQRAIGTLLGGLTVKRDGLSYAISVSYE
DPDSAAVDTEVQALRSPELIGRVVDRLRLARDPAFNNAAGEGQPTAQPDLIGRQRAIGTLLGGLTVKRDGLSYAISVSYE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSTPVQAAQIANALVDDYVSGQVGSKTDATQRASKFLEQRLEELRTQLLRAEREVADYRAAHNLFAVSEASTITQQELSG
GSTPVQAAQIANALVDD                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSTQLAQAKAENAAAQARLSAARAQLAGGRNGEELGDSLDSPVVSQLRAQRAEAGREVAALEKRYGPRHPALMQAQNQLR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TADAAIAAEVQRIVANVSIQASIANQRAGSLAGSVAQSQGKLASDNEASVRLGELERNAESSRTLYQAFLDRYRQTVAQA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLEQSDSYIVSRARVPGAPSSPNMLIYAAMAIVGGLGIGVLLVVLLQLLERGIETSDAIEDMLGLSTLASIPDANTLPGY


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKLGPPAPPAELLLKRPQSTYAEAFRTLRTSIQFAEAASPIRVVAITSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADA
                                              TSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADA
                                                     GKT                 LLIDADA
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRRASSRQFTDGVTLGLDEVLAGQATLDQAIVKDSLSGAFLLPQRIDSKGVGLTESPRLAELIEQVRERYDLVILDTPPV
RRRASSRQFTDGVTLGLDEVLAGQATLDQAIVKDSLSGAFLLPQRIDSKGVGLTESPRLAELIEQVRERYDLVILDTPPV
R                                                                       VILDTPP 
       650       660       670       680       690       700       710        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
LPVDEARVIASMADGVVLLVRWRKTPSKAVSVALRRLYDVHAEMLGAVLTLVDVREQERAGYEDGGTFMKAYRSYYAD
LPVDEARVIASMADGVVLLVRWRKTPSKAVSVALRRLYDVHAEMLGAVLTLVDVREQERAGYEDGGTFMKAYRS    
                                                                       YRSYY  

© 1998-2019