BYKdb

Annotate results for A0A0M9WUY5

A0A0M9WUY5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M9WUY5
DOMAINcd53/235TSSIPGEGKSTNAANIGIVFAQEGKKVLLVDADMRKPTIHHTFHLTNTVGLSSLLIRQKI
LETIIQTTSVEGLSVITSGPIPPNPAELLASKAMNEFFETVKKEFDIVIFDAPPLLSVTD
AQILANKCDGTLLIVNTGVVEKLNVIKAKSILINAQAKILGVVLNNYVFPRNHHSNQYYN
SIE
SITEWalker A60/62GKS
SITEWalker A'80/87LLVDADMR
SITEWalker B160/166VIFDAPP
SITEY Cluster230/231YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFRTKKKRKLLTLARKLVTVYDSKSILSEQFRTIRTNITFSLCEQDEKTMLITSSIPGEGKSTNAANIGIVFAQEGKKVL
                                                    TSSIPGEGKSTNAANIGIVFAQEGKKVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDADMRKPTIHHTFHLTNTVGLSSLLIRQKILETIIQTTSVEGLSVITSGPIPPNPAELLASKAMNEFFETVKKEFDIV
LVDADMRKPTIHHTFHLTNTVGLSSLLIRQKILETIIQTTSVEGLSVITSGPIPPNPAELLASKAMNEFFETVKKEFDIV
LVDADMR                                                                        V
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
IFDAPPLLSVTDAQILANKCDGTLLIVNTGVVEKLNVIKAKSILINAQAKILGVVLNNYVFPRNHHSNQYYNSIE
IFDAPPLLSVTDAQILANKCDGTLLIVNTGVVEKLNVIKAKSILINAQAKILGVVLNNYVFPRNHHSNQYYNSIE
IFDAPP                                                               YY    
© 1998-2019